SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000012412 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000012412
Domain Number 1 Region: 2265-2565
Classification Level Classification E-value
Superfamily BEACH domain 1.31e-127
Family BEACH domain 0.0000000000159
Further Details:      
 
Domain Number 2 Region: 208-399
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.92e-33
Family Clostridium neurotoxins, the second last domain 0.027
Further Details:      
 
Domain Number 3 Region: 2682-2935
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.33e-30
Family WD40-repeat 0.0063
Further Details:      
 
Domain Number 4 Region: 2153-2260
Classification Level Classification E-value
Superfamily PH domain-like 7.99e-30
Family PreBEACH PH-like domain 0.00000266
Further Details:      
 
Domain Number 5 Region: 491-598,677-973
Classification Level Classification E-value
Superfamily ARM repeat 2.4e-16
Family Plakophilin 1 helical region 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000012412
Sequence length 2948
Comment (Monodelphis domestica)
Sequence
MASEKPGPGPGPEPQPAGLIAVGAGAGAGGGPGGSGCGGGVSGLGELRGASSSGSMVLPA
GMINPSVPIRNIRMKFAVLIGLIQVGEVSNRDIVETVLNLLVGGEFDLEMNFIIQDAESI
TCMSELLEHCDVTCQAEIWSMFTAILRKSVRNLQTSTEVGLIEQVLLKMSTVDDMIADLL
VDMLGVLASYSITVKELKLLFSMLRGESGIWPRHAVKLLSVLNQMPQRHGPDTFFNFPGC
SAAAIALPPIAKWPYQNGFTLNTWFRMDPLNNINVDKDKPYLYCFRTSKGVGYSAHFVGN
CLIVTSLKSKGKGFQHCVKYDFQPRKWYMISIVHIYNRWRNSEIRCYVNGQLVSYGDMAW
HVNTNDSYDKCFLGSSETADANRVFCGQLGAVYVFGEALNPAQIFAIHQLGPGYKSTFKF
KSESDIHLAEHHKQVLYDGKLASSIAFTYNAKATDAQLCLESSPKENASIFVHSPHALML
QDVKAIVTHSIHSAIHSIGGIQVLFPLFAQLDNRQLNDSQMETTVCATLLAFLVELLKSS
VAMQEQMLGGKGFLVIGYLLEKSSRVHITRAVLEQFLSFAKYLDGLSHGAPLLKQLCDHI
LFNPAIWIHTPAKVQLSLYTYLSAEFIGTATIYTTIRRVGTVLQLMHTLKYYYWVINPAD
SSGITPKGLDGPRPSQKEIISLRAFMLLFLKQLILKDRGVKEDELQSILNYLLTMHEDEN
IHDVLQLLVALMSEHPASMIPAFDQRNGIRVIYKLLASKSESIWVQALKVLGYFLKHLGH
KRKVEIMHTHSLFTLLGERLMLHTNTVTVTTYNTLYEILTEQVCTQVVHKPHPEPDSTVK
IQNPMILKVVATLLKNSTPSAELMEVRRLFLSDMIKLFSNSRENRRCLLQCSVWQDWMFS
LGYINPKNSEEQKITEMVYNIFRILLYHAIKYEWGGWRVWVDTLSIAHSKVTYEAHKEYL
AKMYEEYQRQEEENIKKGKKGNVSTISGLSSQATGTKGGMEIREIEDLSQSQSPESETDY
PVSTDARDLLMATKVSDDVLGNSDRPGGGVHVEVHDLLVDIKAEKVEATEVKLDDMDLSP
ETLVTGENGALVEVESLLDNVYSAAVEKLQNNVHGSVGMIKKSEEKDNGPLITLADEKDE
PTNNSTSFLFDKIPSQEDKLLPELSSNHIIPNVQETQVHLGVSDDLGLLAHMTSSVDLTC
TSNIIEEKEFKIHTTSDGMSSISERELVSSTKGLEYAEMTATTLETESSGNKVVPNIDAG
SIISDTERSDDGKEAGKEIRKIQTTTTTQAVQGRAITQQDRDLRVDLGFRGMPMTEEQRR
QFSPGPRTTMFRIPEFKWSPMHQRLLTDLLFALETDVHVWRSHSTKSVMDFVNSNENIIF
VHNTIHLISQMVDNIIIACGGILPLLSAATSPTVSTTELESIEVTQGMSAETAVTFLSRL
MAMVDVLVFASSLNFSEIEAEKNMSSGGLMRQCLRLVCCVAVRNCLECRQRQRERVNKSS
LISSKPQEAPQSVTGAATSKTPLESVPGNLSPIKDPDRLLQDVDINRLRAVVFRDVDDSK
QAQFLALAVVYFISVLMVSKYRDILEPQRETARSGSQAGRNIRQEINSPTSTVVVIPSIP
HPSLNHGFLAKLIPEQSFAHSFYKETPAAFQDNMKEKETPTPGEEIQLESSIPHTDSGIG
EEQIPSILNGAELETSAGPDAMSELLSTLSSEVKKSQESLTENPNEMLKPAPSISSISQT
KGINVKEILKSLVAAPVEIPECGPEPIPYPDPALKREAHTILPMQFHSFDRSVVVPVKKA
PPGSLAVTTVGAATAGSGLPTGSTPNIFAATGATPKSMINTTGAVDSGSSSSSSSSSFVN
GATSKNLPAVQTVAPMPEDSAENMSITAKLERALEKVAPLLREIFVDFAPFLSRTLLGSH
GQELLIEGLVCMKSSTSVVELVMLLCSQEWQNSIQKNAGLAFIELINEGRLLCHAMKDHI
VRVANEAEFILNRQRAEDVHKHAEFESQCAQYAADRREEEKMCDHLISAAKHRDHVTANQ
LKQKILNILTNKHGAWGAVSHCQLHDFWRLDYWEDDLRRRRRFVRNAFGSTHAEALLKAA
AEYGTEEDVLKSKKTFRSQAVVNQNAETELMLEGDDDAVSLLQEKEIDNLAGPVVLSTPA
QLIAPVVVAKGTLSITTTEIYFEVEEDDPAFKKVDPKVLAYTEGLHGKWMFSEIRAVFSR
RYLLQNTALEVFMANRTSVMFNFPDQATVKKVVYSLPRVGVGTSYGLPQARRISLATPRQ
LYKSSNMTQRWQRREISNFEYLMFLNTIAGRTYNDLNQYPVFPWVLTNYESEELDLTLPG
NFRDLSKPVGALNPKRAVFYAERYETWEDDQSPPCHYSTHYSTSPSTLSWLLRIEPFTTF
FLNSNDGKFDHPDRTFSSVARSWRTSQRDTSDVKELIPEFYYLPEMFVNSNGYNLGVRED
EVAVNDVDLPPWAKKPEDFVRINRMALESEFVSCQLHQWIDLIFGYKQRGPEAVRALNVF
HYLTYEGSVNLDSITDPVLREAMEAQIQNFGQTPSQLLIEPHPPRSSAMHLCFLPQSPLM
FKDQMQQDVIMVLKFPSNSPVTHVAANTLPHLTIPAVVTVTCSRLFAVNRWHNTVGLRGA
PGYSLDQAHHLPIEMDPLIANNSGVNKRQITDLVDQSIQINAHCFVVTADNRYILICGFW
DKSFRVYSTETGKLTQIVFGHWDVVTCLARSESYIGGDCYIVSGSRDATLLLWYWSGRHH
IIGDNPNSSDYPAPRAVLTGHDHEVVCVSVCAELGLVISGAKEGPCLVHTITGDLLRALE
GPENCLFPRLISVSSEGHCIIYYERGRFSNFSINGKLLAQMEINDSTRAILLSSDGQNLV
TGGDNGVVEVWQACDFKQLYIYPGCDAGIRAMDLSHDQRTLITGMASGSIVAFNIDFNRW
HYEHQNRY
Download sequence
Identical sequences 13616.ENSMODP00000012412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]