SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000012598 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000012598
Domain Number 1 Region: 21-221
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.53e-41
Family Pentraxin (pentaxin) 0.000000413
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000012598
Sequence length 222
Comment (Monodelphis domestica)
Sequence
MEKLPLCFLVIMSLSHALAQTDLSGKAFVFPKQSEDSYVTLIPHLEKSLNAFTVCLKVYT
ELTRKYTLFSFATQTLDNEILLFEGNSKYSLSVGNVAVVFQVPAVTFEPRHFCASWESES
GIAELWVDGKPMGRKSLKMGYVVGKQSKIILGQEQDSFGGGFDEKQSLVGDIGDIVMWDF
ALSPEEISNVYIGGTFSPNVLDWRGLNFEKKGYVVIKPKLWI
Download sequence
Identical sequences 13616.ENSMODP00000012598

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]