SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000012902 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000012902
Domain Number 1 Region: 309-483
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.35e-52
Family SPRY domain 0.0000384
Further Details:      
 
Domain Number 2 Region: 33-145
Classification Level Classification E-value
Superfamily Immunoglobulin 1.23e-17
Family V set domains (antibody variable domain-like) 0.00023
Further Details:      
 
Domain Number 3 Region: 156-231
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000103
Family C2 set domains 0.027
Further Details:      
 
Weak hits

Sequence:  13616.ENSMODP00000012902
Domain Number - Region: 3-31
Classification Level Classification E-value
Superfamily alpha-helical ferredoxin 0.0277
Family Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000012902
Sequence length 486
Comment (Monodelphis domestica)
Sequence
IKPSFCIQCKPCSLHCQMFLINKTFLVIPTGQFQVIGPNNPIQALIGEDVLFSCHISPKM
NVKNMEVRFFRNQFSSVLLLYKDGKEIDERQMQEYQGRTQFMQDAITEGTVSLKLKNIVS
SDMAKYGCWFSSKTFYEEYTWELQVVALGSTPLISLEGNRDGGILLVCQSSGWLPQPKIQ
WRYDPDQYLLLNYTVNQDDHGLFSIKTTLTIKEHSNKNISCLVLNLALGQMKESRLQIAG
EVSPLSCPLNRCIQAVAFPWFLFLLFCTRPFLFLGDFISQCHLISALLFLELMEKLKEAG
KRTTFLSFQILLLHSLEVTLDPDTAHHKLHVSEDQKSVTHEDGVIYEDNGLENNIRFQFP
CVMASQSFSSGKHYWEVEVGKMKKWYLGVCWNDVTREKEKVMFSPDKGYWILGLWNKSEY
FTYTPYRKALRFSVEPHRVGVFINYEAKEISFFNVNDRSHIYTFTNCDFKGKALYPCFCP
HKSDSP
Download sequence
Identical sequences 13616.ENSMODP00000012902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]