SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000013262 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000013262
Domain Number 1 Region: 43-172
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.4e-49
Family Calponin-homology domain, CH-domain 0.000000574
Further Details:      
 
Domain Number 2 Region: 243-303
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 4.18e-19
Family EB1 dimerisation domain-like 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000013262
Sequence length 326
Comment (Monodelphis domestica)
Sequence
MPGPTQTLSPNGENNNDIIQDNGTIIPFRKHTVRGERSYSWGMAVNVYSTSITQETMSRH
DIIAWVNDIVSLNYTKVEQLCSGAAYCQFMDMLFPGCISLKKVKFQAKLEHEYIHNFKLL
QASFKRMNVDKVIPVEKLVKGRFQDNLDFIQWFKKFYDANYDGKEYDPVEARQGQDAIPP
PDPGEQIFNLPKKSHHANSPTAGAAKSSLASKPGSTSSRPSSAKRTPSSSGSASKSEKDL
ETQVIQLNEQVHSLKLALEGMEKERDFYFGKLRDIELICQEHGQENDDLMQRLMEVLYAS
DEQESHTEEPEAEEQVHEQPQQQEEY
Download sequence
Identical sequences F7GHT2
13616.ENSMODP00000013262 ENSMODP00000013262 ENSMODP00000013262 XP_001368954.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]