SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000013770 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000013770
Domain Number 1 Region: 128-208
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 7.89e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0024
Further Details:      
 
Domain Number 2 Region: 39-105
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000877
Family Eukaryotic type KH-domain (KH-domain type I) 0.0028
Further Details:      
 
Domain Number 3 Region: 410-458
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000126
Family RING finger domain, C3HC4 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000013770
Sequence length 463
Comment (Monodelphis domestica)
Sequence
MLSHAYGPGGCGGAAAAAAALNGEQAALLRRKSVNTTECVPVPSSEHVAEIVGRQGCKIK
ALRAKTNTYIKTPVRGEEPIFVVTGRKEDVAMAKREILSAAEHFSMIRASRNKNGPALGG
LPCTPNLPGQTTVQVRVPYRVVGLVVGPKGATIKRIQQQTHTYIVTPSRDKEPVFEVTGM
PENVDRAREEIEMHIAMRTGNYIELNEENDFHYNGTDVSFEGGTLSSAWLSSNPVPPSRT
RMISNYRNDSSSSLGSGSTDSYFGSNRLADFSPTSPFSTGNFWFGETLPSVGSEDLAVDS
PAFDSLPTSSQTIWTPFEPVNPLSGFGGDPSGNMKTQRRGSQPSTPRLSPTFPEGIEHPL
ARRVRSDPPSTGNHVGLPIYIPAFSNGTNSYSSSNGGSTSSSPPESRRKHDCVICFENEV
IAALVPCGHNLFCMECANKICEKRTPSCPVCQTAVTQAIQIHS
Download sequence
Identical sequences 13616.ENSMODP00000013770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]