SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000014270 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000014270
Domain Number 1 Region: 123-625
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.88e-160
Family Calponin-homology domain, CH-domain 0.00000000293
Further Details:      
 
Domain Number 2 Region: 8-97
Classification Level Classification E-value
Superfamily EF-hand 1.78e-18
Family Calmodulin-like 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000014270
Sequence length 632
Comment (Monodelphis domestica)
Sequence
LKAIKMARGSVSEEEMADLREAFSKVDTDGNGYISCNELNDLFKAACLPLPGYRIREITE
KLMATGDLNHDGRISFDEFISVFHGLKSTEVAKTFRKAINKKEGICAIGGTSEQSSVGTQ
HSYSEEEKYAFVNWINKALENDPDCKHVLPMDPNTDDLFTSVGDGIVLCKMINLSVPDTI
DERTINKKKLTPFTIQENLNLALNSASAIGCHVVNIGAEDLKEGKPYLVLGLLWQVIKIG
LFADIELSRNEALIALLREGESLEDLMKLSPEDLLLRWANYHLENSGCNKINNFSNDIKD
SKAYFHLLEQVAPKGDEEGIPAITIDMSGIREKDDIQRAECMLQQAERLGCRQFVTATDV
VRGNPKLNLAFIANLFNRYPALHKPENQDIDWGSLEGETREERTFRNWMNSLGVSPRVNH
LYSDLSDSLVIFQLYEKIKVPVDWNRVNKPPYPKLGGNMKKLENCNYAVELGKNQAKFSL
VGIAGQDLNEGNRTLTLALIWQIMRRYTLSILEDIGGGQKVYDDIIVSWVNETLKEAEKS
SSISSFKDPKISTSMPVLDLIDAIQAGSIKYDLLKTDDLNDEEKLNNAKYAISMARKIGA
RVYALPEDLVEVKPKMVMTVFACLMGKGMKKV
Download sequence
Identical sequences F6S548
ENSMODP00000014270 13616.ENSMODP00000014270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]