SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000014513 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000014513
Domain Number 1 Region: 275-595
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.06e-82
Family Ankyrin repeat 0.00000701
Further Details:      
 
Domain Number 2 Region: 952-1280
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.37e-82
Family Ankyrin repeat 0.00000723
Further Details:      
 
Domain Number 3 Region: 102-302
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.88e-52
Family Ankyrin repeat 0.00015
Further Details:      
 
Domain Number 4 Region: 1597-1670
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.68e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000014513
Sequence length 2458
Comment (Monodelphis domestica)
Sequence
LKQVESFILDQEDLDNPVLKTTSELFLSSAAEGTDLRTVDPETQARLEALLEAAGIGKLS
TADGKAFADPEVLRRLTSSVSCALDEAAAALTRMRAENSHNTGQVDNRSLAEACSDGDVN
AVRKLLDEGRSVNEHTEEGESLLCLACSAGYYELAQVLLAMHANVEDRGNKGDITPLMAA
ASGGYVDIVKLLLVHCADVNAQSSTGNTALTYACAGGFVDIVKVLLKAGANIEDHNENGH
TPLMEAASAGHVEVARVLLEYGAGINTHSNEFKESALTLACYKGHLDMVRFLLEAGADQE
HKTDEMHTALMEACMDGHVEVARLLLDSGAQVNMPADSFESPLTLAACGGHVELAALLIE
RGANLEEVNDEGYTPLMEAAREGHEEMVALLLAQGANINAQTEETQETALTLACCGGFSE
VADFLIKAGADIELGCSTPLMEAAQEGHLELVKYLLAAGANVHATTATGDTALTYACENG
HTDVADVLLQAGADLEHESEGGRTPLMKAARAGHLCTVQFLISKGANVNRATANNDHTVV
SLACAGGHLAVVELLLAHGADPTHRLKDGSTMLIEAAKGGHTNVVSYLLDYPNNILSVPA
TDMSQLTPPSQDQSQVPRVPVHALAMVVPPQEPDRAPQDSSPTLLGVQKGTSKQKSSSLQ
VADQDLLPSFHPYQPLECIVEETEGKLNELGQRISAIEKAQLKSLELIQGEPLNKDKIEE
LKKNREEQVQKKKKILKELQKVERQLQMKTQQQFTKEYLETKGQTDPSLAQQQCPHRGVF
PEGEGDDSIPEDSFSVLPQVDAVLAKEEDDDDEQQSSRPAEQIDFVPVQPLPSSQCNFSG
DLGYNGTNSLELQKALGNQQNVGQQQIAGHGQGLLVQEPDGLMVATPAQTLTDTLDDLIA
AVSSRVPTGSNSSSRTTESPTPESCSQTPSNVASQPMLPMYPSVDIDAHTESNHDTALTL
ACAGGHEELVSVLIARDAKIEHRDKKGFTPLILAATAGHVGVVEILLDKGGDIEAQSERT
KDTPLSLACSGGRQEVVDLLLARGANKEHRNVSDYTPLSLAASGGYVNIIKILLNAGAEI
NSRTGSKLGISPLMLAAMNGHVPAVKLLLDMGSDINAQIETNRNTALTLACFQGRAEVVS
LLLDRKANVEHRAKTGLTPLMEAASGGYAEVGRVLLDKGADVNAPPVPSSRDTALTIAAD
KGHYKFCELLINRGAHIDVRNKKGNTPLWLAANGGHFDVVQLLVQAGADVDAADNRKITP
LMSAFRKGHVKVVQYLVKEVNQFPSDIECMRYIATITDKELLKKCHQCVETIVKAKDQQA
AEANKNASILLKELDLEKVNGETLNNEIDILGNKGEMKTKMLNTKEKTIEEDEENKPKEN
LELPEDDDEEENDEEEQEVPIEPPSATTTTTIGISATSTTFTNVFGKKRANVVTTPSTNR
KNKKNKTKETPPTVHLILPDQHISLAQQKADKNKINGEPRGGGGAGGNSDSDNLDSTDCN
SESSSGGKSQELNFTMDVNSSGDRRYTSLLIHSHEEKTSTTTSKIQTRLEGDANPNSLST
SYKSVSLPMNSPNIKLNLTSPKRGQKREEGWKEVVRRSKKLSVPASVVSRIMGRGGCNIT
AIQDVTGAHIDVDKQKDKNGERMITIRGGTESTRYAVQLINALIQDPAKELEDLIPKNHI
RTPASTKSIHANFSSGVGTTAASNKNAFPLGAPALVTTQATTLSTFQPTNKLNKNVPANV
RSSFPVSLPLAYSHPHFALLAAQTMQQIRHPRLPMAQFGGTFSPSPNTWGPFPVRPVNPG
STNSSPKHNSAGRLPNQNGNILQSESTGLSATSCPITVSSVVATNQPLCVTNSRTPSSVR
KQLFACVPKTSTMATVISTVTSTCSSLPSVSSAPISSGQVPTAFLPSSAPQTQISVHKTD
SFSAMSTPKEKVSTQDQPVGNLCTPSSVANNCSISASNNPGTLETRSSSSPAPLNNTQEE
VLPANISDLSPMSLPFASNSEPAPLSLASPRSVAADNQDTSNLPQLAVPAPRVSHRMQPR
GSFYSVVPNATVHQDPQSIFVTNPVPLTPPQGPPSAVQLSSAMNIMNGSQMHINPANKSL
PPTFGPATLFNHFSSLFDSNQVPANQGWGDCPLSSRAATDPSFTVQSTFLGNSVLGHLEN
VHPDNSKAPGFRPPSQRVSTSPVGLPSIDPSGNSPSSSSAPLTSFSNIQGTRVFLQGPAP
VGTPSFNRQHFSPHPWTSASNSCDSPIPSVSSGSSSPLSATSAPPTLGQPKGGNPSQDRK
VPPPIGTERLARIRQGGSVTPTPLGTNFTAPVGHSGIWSFGVNSVSGLSGWSQPMMGNHP
LHQQLSDPGTFSQHQPLERDDSGMVAPSNIFHQPMASSFVDFSKGLPISMYGGTIIPSHP
QLADGPGGPLFNGLHNPDPAWNPMIKVVQNSTDCTDAQQIWPGTWAPHIGNMHLKYVN
Download sequence
Identical sequences 13616.ENSMODP00000014513

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]