SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000014528 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000014528
Domain Number 1 Region: 289-467
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.96e-42
Family SPRY domain 0.00029
Further Details:      
 
Domain Number 2 Region: 87-149
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000121
Family B-box zinc-binding domain 0.0019
Further Details:      
 
Domain Number 3 Region: 6-61
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000101
Family RING finger domain, C3HC4 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000014528
Sequence length 472
Comment (Monodelphis domestica)
Sequence
MDPVTLVQSLQQETTCGICLTFFTKPVTLNCGHNFCQFCLSRSREAGVTHFSCPECREVC
QSFPGLNVRLSKLAAICKKLSAQNLQNPVGQRCCQEHQQVPKVFCKEDQTTLCLTCTEAQ
EHETHTLSPIDEAAQNFREKLLDTMPSLRKKIKELKELNVSKKDVSVLFLQREVKWRKLI
RGEYARMHQFLKEEEHRCLDVVTNDEAMTNQLMDSYYNELHQHFKNMEDTVREMEETKRR
PDLELLQAQVFHPRAKRISCQLVFLLVLKKLNCPMNPETGHLTFPSLLSAVNVTMDPTTV
NPYFVLSENLKSVKLKNNSLDQPDCAGKVQHFILGQPAFSSGAYYWEVDVSEQPQWALGI
SVKCLKKRKTIQYTAGYLYMLRCEKRGNEFYLVTRPGLVCQLMKVPVPVVGIYLDCNDRT
LLFYNATKASLIYEMHIMPFKEPVRPLFCPCPPMLGTKIGSMTICPVKCNIC
Download sequence
Identical sequences 13616.ENSMODP00000014528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]