SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000014592 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000014592
Domain Number 1 Region: 510-690
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.14e-45
Family SPRY domain 0.0022
Further Details:      
 
Domain Number 2 Region: 165-230
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 4.58e-17
Family B-box zinc-binding domain 0.0000182
Further Details:      
 
Domain Number 3 Region: 2-88
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000139
Family RING finger domain, C3HC4 0.025
Further Details:      
 
Domain Number 4 Region: 375-423,467-515
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000535
Family Fibronectin type III 0.0028
Further Details:      
 
Weak hits

Sequence:  13616.ENSMODP00000014592
Domain Number - Region: 110-162
Classification Level Classification E-value
Superfamily RING/U-box 0.0113
Family ZZ domain 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000014592
Sequence length 717
Comment (Monodelphis domestica)
Sequence
METLESELTCPICLELFEDPLLLPCAHSLCFSCAHRILVSSCSSGESVEPIAAFQCPTCR
YVISLTHRGLDGLKRNVTLQNIIDRFQKASLSGPNSPGESCRERTYRPSPTMSSERIACQ
FCEQAPPRDAVKTCITCEVSYCDRCLRATHPNKKPFTSHRLVEPVPDTHLRGLMCLEHEN
EKVNMYCVADDQLICALCKLVGRHRDHQVASLSDRFEKLKQTLEMNLTNLVKRNSELENQ
MAKLIQICQQVEVNTAMHEAKLMEECDELMEIIQQRKQAIAVKIKETKVMKLRKLAQQVA
NCRQCLERSTVLINQAERILKENDQARFLQSAKNVVERVAMATASSQVLIPDINFNDAFE
NFALDFSREKKLLEGLDYLTAPNPPSIQEELCTASHDTITVHWLSEDEFSISSYELQYTI
FTGQANFISKSWCGWGLWPEIRKCKEAVSCSRLTGAARGKCLYNSVDSWMIVPNIKQNHY
TVHGLQSGTRYIFLVKAINQAGSRNSEPTRLKTNSQPFKLDPKMTHKKLKISNDGLQMEK
DESSLKKSHTPERFSGTGCYGATGNVFLDSGCHYWEIVMGSSTWYAVGVAYKSAPKNEWI
GKNSSSWVFSRCSSNFVVRHNNKEMLVDVPPQLKRVGVLLDYDNNMLSFYDPANSLHLHT
FNVSFILPVCPTFTIWNKSLMILSGLPVPDFIDYPERHECNCRPQESPYVSGMKACH
Download sequence
Identical sequences 13616.ENSMODP00000014592

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]