SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000014769 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000014769
Domain Number 1 Region: 228-302
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.1e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.00012
Further Details:      
 
Domain Number 2 Region: 54-82,120-171
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000024
Family Eukaryotic type KH-domain (KH-domain type I) 0.0031
Further Details:      
 
Weak hits

Sequence:  13616.ENSMODP00000014769
Domain Number - Region: 2-40
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000964
Family Eukaryotic type KH-domain (KH-domain type I) 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000014769
Sequence length 401
Comment (Monodelphis domestica)
Sequence
SSARITISEGSCPERITTITGSTGAVFHAVSMIAFKLDEDLCTGPPNGGSISKPPVTLRL
VIPASQCGSLIGKAGTKIKEIREVWKPSWGKSRERLAFPALPRVMSLPFHSYEPHTYQGE
TTGAQVQVAGDLLPNSTERAVTVSGVPDAIILCVRQICAVILESPPKGATIPYHPSLSLG
TVLLSANQGFSVQGQYGTVTPAEVSKLQQLSGHPVPFASPSVVPGLDPSAQTSSQEFLVP
NDLIGCVIGRQGSKISEIRQMSGAHIKIGNQAEGSGERHVTITGSPVSIALAQYLITACL
ETAKSTSGGTPGSGTADLSAPFSPPLAPSPALTALPAAPPGLLGTPYAISLSNFIGLKPV
PFLALPPSSPGPPPSGLTAYTAKMAAANGNKKSERQKFSPY
Download sequence
Identical sequences 13616.ENSMODP00000014769

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]