SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000015162 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000015162
Domain Number 1 Region: 159-234
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.39e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000242
Further Details:      
 
Domain Number 2 Region: 66-146
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.61e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.000032
Further Details:      
 
Domain Number 3 Region: 353-450
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.82e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000841
Further Details:      
 
Domain Number 4 Region: 251-324
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000234
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000489
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000015162
Sequence length 575
Comment (Monodelphis domestica)
Sequence
MAELVQGQSAAPVGMKSDGLVDALTRIAAKIGDAIPHLNNSTPLVDPSVYGYGVQKRPLD
DGVGNQLGALVHQRAVITEEFKVPDKMVGFIIGRGGEQISRIQAESGCKIQIAPESSGIP
ERPCVLTGTPESIEQAKRLLGQIVDRCRNGPGFHNDVDGNNTIQEILIPASKVGLVIGKG
GETIKQLQERTGVKMIMIQDGPLPTGADKPLRITGDPFKVQQAREMVLEIIREKDQADFR
GVRSDFSSRMGGGSIEVSVPRFAVGIVIGRNGEMIKKIQNDAGVRIQFKPDDGISPERVA
QVMGLPERCQHAAHVISDLILTAQERDGFGSLSVPRGRGRGRSDWSIGAPGGLQEVTYTV
PADKCGLVIGKGGENIKSINQQSGAHVELQRNPPPNTDPSVRIFTIRGVPQQIELARHLI
DEKVGGTNMGAPGGFGQSPFNQAPATPHQNTFPPRSSGCFPNIAAKNECFIIHSGPQAFM
TQGWGSTYQTWQTPAQQVPSQQSQQQNSQPGYSKAWEDYYKKQSHATNAASQASSPPDYT
MAWAEYYRQQAAYYGQTLGQAQAHSQVCISLNTAE
Download sequence
Identical sequences 13616.ENSMODP00000015162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]