SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000015699 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000015699
Domain Number 1 Region: 261-439
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.45e-56
Family SPRY domain 0.00017
Further Details:      
 
Domain Number 2 Region: 23-81
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000366
Family B-box zinc-binding domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000015699
Sequence length 444
Comment (Monodelphis domestica)
Sequence
AAAATATAAAEFVGRERPKPALTWLCSEHPRRVIELFCSRCQSCVCALCPLLGSHRSHPV
RLIQEEVVLKQKSIQKCLKQLALKKKQEVANINQLNEAANNLKEHSEAAKIWLTGKFTEL
RLLLDEEEMTAKQFIDKNTQKTFKTYDEQVELCQERINIINNLSKKVQRIHEQQDPVHLL
KDYTVSEKEIIRQMSPAEVCHPVPVTFEHEKNYYRNLAKDVCTTLQVPLEVRLKEDTCSQ
PSVSYKSKSGTLLKMVSTPERSLFLKYARIPTLEPDTMHPRLRLSDDRLTVTCVWMGKIQ
LCNPQRFDKLWQVLSRDSFFSGSHYWEVDLLNSGIGWWLGVAYPSIKRKGNSEASRLGFN
RQSWCLKRFDLEYWAFHNGERTRITVDQDPERIGIFLDYEAGILSFYDITCGMSHLHTFR
SRFQEPLYPALRLWEGSITILKLP
Download sequence
Identical sequences 13616.ENSMODP00000015699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]