SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000015804 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000015804
Domain Number 1 Region: 2-124,158-264
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.04e-74
Family Calponin-homology domain, CH-domain 0.0000541
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000015804
Sequence length 1008
Comment (Monodelphis domestica)
Sequence
VERENVQKRTFTRWINLHLEKCNPPLEVKDLFIDIQDGKILMALLEVLSGQSLLHEYKSS
SHRIFRLNNIAKALKFLEDSNVKLVSIDAAEIADGNSSLVLGLIWNIILFFQIKELTGNL
NRNASSSSLSSGPPGPDSDSSLPATPKGENSVALSVKDQRKAIRTLLNWVQRRTRKYGVA
VQDFAGSWRSGLAFLAIIKAIDPSLVDIKQALENSARENLEKAFSIAHDKLQIPRLLEPE
DIMVDTPDEQSIVTYVAQFLEHFPGLEGEDFMDPDKEIPIESTFVRIKETPTEQEGKIFL
LTENGEHTYTINCETSQPPPPIVFVCDNPEVGKELVTDESPSDSSSRRYSDSPENELSYI
AEQVFPGGFNKPNDINESLSEPSILISKKADHRPDSLPVKKSVHFESDVSKDASCSKDIN
FKGDSEMINETLAQDDSVSSSGVCNKIKFKEGRMKSLGSALNKILDDYPLTHKKNGGFST
SDILPGNAEEDVEANEGNDAHPHSSEIRDEKVIQKALVEAGGFEEMAVKATTAHSPEMKD
QTLRDENSAPVEKNVARDGVSSKANVKQLTKKASKCHHKMKDSTADNSDTDLRSSEVPTV
DSRDSSLVTPDEDIYNYVLHLQEEAVMTELDVSEKAKQQPVNKDQEEKAPPDNHLEIQED
VEDEFSTPLSSVSLETLGSQSEDSLDLKLSPPSSKVSVIPHDLFYYPHYDVPLSAVLEAY
VEASHGSQNEEIVPEKSTEDAQELDTTGEDPQKGCKSNSSFLVTELSAEVPQMDLPSHPA
ETEPSSETVEKKSHVEHKGKDPPNTDSVDNSQSQDFQNVGKLDVSLEKLPEEATSAKKHE
EWNHGDQAESSLFVAARAAHFSEDLEEEIIDHKVISRTSHSDTSLYIRRQSNKPSEMDHY
SHARLRPTEMEERRNRLFRYHSKKLPELIFQVYGIKTSEEGMQKYKEVFEIILLKANNFG
EAMLHGHHGASDSLVHFAQQQDLVYFILFLWLLVYCLLLFPQLDIKKL
Download sequence
Identical sequences 13616.ENSMODP00000015804

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]