SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000015882 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000015882
Domain Number 1 Region: 455-666
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.18e-31
Family Laminin G-like module 0.014
Further Details:      
 
Domain Number 2 Region: 903-1106
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.68e-26
Family Laminin G-like module 0.014
Further Details:      
 
Domain Number 3 Region: 681-882
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.36e-23
Family Laminin G-like module 0.016
Further Details:      
 
Domain Number 4 Region: 217-259
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000347
Family EGF-type module 0.005
Further Details:      
 
Domain Number 5 Region: 141-181
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000215
Family EGF-type module 0.0047
Further Details:      
 
Domain Number 6 Region: 1290-1331
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000458
Family EGF-type module 0.0051
Further Details:      
 
Domain Number 7 Region: 296-337
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000185
Family EGF-type module 0.012
Further Details:      
 
Domain Number 8 Region: 1133-1180
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000207
Family EGF-type module 0.0077
Further Details:      
 
Domain Number 9 Region: 179-219
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000603
Family EGF-type module 0.0047
Further Details:      
 
Domain Number 10 Region: 1194-1327
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000251
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 11 Region: 255-294
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000274
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 12 Region: 63-103
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000179
Family EGF-type module 0.013
Further Details:      
 
Domain Number 13 Region: 105-146
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000017
Family EGF-type module 0.017
Further Details:      
 
Domain Number 14 Region: 390-419
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000768
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 15 Region: 332-394
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000116
Family EGF-type module 0.012
Further Details:      
 
Domain Number 16 Region: 884-932
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000314
Family EGF-type module 0.024
Further Details:      
 
Weak hits

Sequence:  13616.ENSMODP00000015882
Domain Number - Region: 25-52
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00468
Family EGF-type module 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000015882
Sequence length 1399
Comment (Monodelphis domestica)
Sequence
NYLLLFYLNCLAHYLTQSFCIGNDTECFSNPCPNNSTCDDAGKDSTCHCSGTTENVGEDC
IKKLVSCSSKPCKRNGFCFDLDEEPGFLCRCPPGYGGKHCEITFTSCVSGFCRHGGICHE
GTSGPFCDCPDGFIGKHCETDFNECASNPCRNGAVCQDGINGYSCFCVPGFQGRYCDREV
DECVSNPCYNGAKCHNKVGSYICDCLPEYFGTNCEFEIDQCLSQPCLNGGTCQDSVGRYF
CDCASGFRGEHCEINTNECLSQPCLNQGKCTDGYNSYSCNCDDTGFTGTHCEISLSVCSS
KPCHNNGTCEEFDDTFICHCWPGFTGSQCEIDINECSSNPCLSTGECVERSWASHYGKIP
ELPSEFNYLQATGYVCHCQPGYTGSRCEDDIDECSSNPCRNGGMCENIPGNYTCHCPPKD
YQGIVYGGVDCREIFLGCTQDKCQNNGICIPYVQNGQHEFSCLCPSGYSGSLCDIMTTLS
FEGNSFLWITSTPGPIKDSLSNIALSFQTVQPSALLLLRGDKDTHVKLELWNGYVSLSIQ
ANNQSKVLLHISHNVSDGEWHSVEVTLAEAVTLTLRDDSCVEKCVNKTPSPIERDQVMIA
FQNTFLGGLPVGKTNDGATLLNIYNMHSAPSFVGCLQDIEIDLNLITSENISSGSSFNVK
AGCDRKYWCENHPCQNRGRCVNLWLSYQCDCYRPYEGLNCLREYTPGRFGQDDSTGYALF
RLDNNPEEIVTLSMFVRTRRSFGFLLALRNSTFQYLSVWLEHGRLAVLAPSSPKLLGRSL
LNDGNIHLISLKIIPNKIELYQSSQNLGSLSTSTWKIQTGDILYIGGLPDKKGTEVWGGY
FKGCIQDIRLNSQKLEFFPITKGNSTLNQTLVNVTPGCTGDNLCKYNPCHNGGVCYSIWD
DFTCSCPPNTAGKACEEVKWCELSPCPPEFQCQLVSKGFECIASAVFSGRESAIFFRSNG
KITRELTNITFGFRTRDSDVILLYAEKEPEFITISIQNSRLIFQLQSGNSFYMLSLKSMQ
PVSDGMWHQVFLSMIEPLAQSSRWRMEVDDQTTIVTSAVATGNLNFLREETNIYLGDKPF
DNLDGLRGCLSSIEIGGIYLSYFENADGHTKKPQDEQFLKISTNSVVTGCLQVDACNSDP
CWHDGDCEDFYNSYGCVCPIGWTGAHCEINIDECFSKPCVYGNCSDRIAGYTCKCNPGYT
GVNCETNIDDCENHRCANGATCIDGINGYSCLCFGNYTGKLCRQTRLPMTVCGNERRNLT
CYNHSNCTELQGDLKCVCRPGFTGEWCEKDINECDSDPCLNGGLCQNLLNTFQCNCDGNF
AGERCELDLTDNLISDIFTAIGSITLAVLLILFLAVVASFIASNKRANQGTYSPSRQEKE
GSRVEMWNMVQPPPMERLI
Download sequence
Identical sequences 13616.ENSMODP00000015882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]