SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000016799 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000016799
Domain Number 1 Region: 34-138
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.71e-37
Family Cold shock DNA-binding domain-like 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000016799
Sequence length 138
Comment (Monodelphis domestica)
Sequence
LIWKCVLHGLGRARSPGPTLVPKLLQCCPMATLNQMHRRGRPKWPEAAPSPMNRCPQLKA
VVLKTMIRKPKKPNSANRKCCRVRLSTGREAICFIPGEGHNLQEHHVVLVEGGRTQDLPG
IKLKVVRGKYDCSHVQKK
Download sequence
Identical sequences 13616.ENSMODP00000016799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]