SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000017182 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000017182
Domain Number 1 Region: 17-158
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 9.82e-43
Family Calponin-homology domain, CH-domain 0.000000202
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000017182
Sequence length 201
Comment (Monodelphis domestica)
Sequence
MANKGPSYGMSREVQSKIEKKYDDELEERLVEWIIVQCGSDVGRPDRGRLGFQVWLKNGV
ILSKLVNSLHPEGSKPVKVPENPPTMVFKQMEQVAQFLKAAEDYGVIKTDMFQTVDLFEG
KDMAAVQRTLMALGSLAVTKNDGHYRGDPNWFMKKAQEHKREFTDSQLQEGKHVIGLQMG
SNRGASQAGMTGYGRPRQIIS
Download sequence
Identical sequences F6X7N5
ENSMODP00000017182 XP_001370893.1.35504 ENSMODP00000017182 13616.ENSMODP00000017182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]