SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000018224 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000018224
Domain Number 1 Region: 282-465
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.38e-42
Family SPRY domain 0.00031
Further Details:      
 
Domain Number 2 Region: 15-84
Classification Level Classification E-value
Superfamily RING/U-box 6.63e-19
Family RING finger domain, C3HC4 0.017
Further Details:      
 
Domain Number 3 Region: 100-151
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000641
Family B-box zinc-binding domain 0.0046
Further Details:      
 
Weak hits

Sequence:  13616.ENSMODP00000018224
Domain Number - Region: 142-241
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0889
Family Myosin rod fragments 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000018224
Sequence length 465
Comment (Monodelphis domestica)
Sequence
AEKGKKMASCSELIQDFQEELICSICKDYFTNPMSIKCGHSFCHSCLFNWEQEASNSFFC
PECKVVSHVRDFVANVHLGKLAGIAKKLQCLQNPEGYSNQKEQKLFCENDQSFSCLSFSE
SQKHKAHALYCIDETTQDISKKLQEILTDLRKKLKNAEQQMANEELKLAQFEEEMTIQKG
NISLEFQKLHVFLGEEEAECLSSVQRQGKANLEGLKKRIRRLSHQSQELSKRITEIDEEC
RKPDVDLLQDIKGTLKRNEYLLQEEIENFALKSIVCSIPGIIEMLLKFKIDITLNDKTAS
PGLIISEDLKSARYGAAQLEVLSNSERRTNFAKVCAVQYFISGRFYWEVEVPSNTEWGVG
IAKGQNPLEEFFVLMATQSQNGFNLYVIGKCYVSSEPDVKFCYNCMTKLVVGVFLDCEHR
EISFYNVKERSLIFTFPTISFSGPVCPVFFLSTKVETNNSSLMIC
Download sequence
Identical sequences F7A4T1
13616.ENSMODP00000018224 ENSMODP00000018224 ENSMODP00000018224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]