SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000018306 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000018306
Domain Number 1 Region: 312-466
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.31e-33
Family SPRY domain 0.001
Further Details:      
 
Domain Number 2 Region: 150-261
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000144
Family Fibronectin type III 0.0022
Further Details:      
 
Weak hits

Sequence:  13616.ENSMODP00000018306
Domain Number - Region: 3-110
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000127
Family Formin homology 2 domain (FH2 domain) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000018306
Sequence length 488
Comment (Monodelphis domestica)
Sequence
EALQRIITTLASKNDEIQNFIDTLNHTLKGVQANSSSILLELDEEFDGLYSILDEMKESM
TNTIKQEQARKSQELQSQLSQCNNALENSEELLEFASRSLDIKEPEEFSKAARQIKDRVT
MASAFRLSLKPKVSDNMTHLMVDFSQERQMLQTLKFLPVPKAPEIDPVECLVADNCVTVA
WRMPEEDNKIDHFTLEYRKTNFDGLPRVKDERCWELIDYIKGTDYTLSGLKFDSKYMNFR
VRACNKAVAGEYSDPITLETKALNFSLDGSSSHLNLKVDDNCVEWDPTGGKSQENKMKGK
ENKGRSGTPSPKRTSVGSRPSSIRGSRDRFTGESYTVLGDTAIESGQHYWEIRAQKDCKS
YSVGLAYKTLGKFDQLGKTNTSWCIHVNNWLQSTFAAKHNNKAKALDVIVPERIGVFCDF
DGGQLSFYNAASKQLLYSFKTKFTQPVLPGFMIWCGGLSLSTGLQVPSAVKTLQKHENGM
SGSTSSLN
Download sequence
Identical sequences 13616.ENSMODP00000018306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]