SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000018630 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000018630
Domain Number 1 Region: 144-190
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000293
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 2 Region: 115-150
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000407
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000018630
Sequence length 294
Comment (Monodelphis domestica)
Sequence
MGSRDRVLLCSLLVGFSVLMLLGGQRLNGDLPFSKGVCSRQTLVVPLRYNESYSQPIYKP
YLTLCAGRRVCSTYRTTYRVAWREVRREVQQIHAICCQGWRKKHPGALTCEEAICAKPCQ
NGGICMQPDQCDCTPGWGGKHCHVDVDECRTGITLCSHSCSNTLGSFICSCPKGLALGSD
GRTCEEIHPEPLPSPSILSLTVREAEKEEHSLRQEIGELRGRLEVLEQWAGHASAWVRAM
LPVSPEAIRPEQVAELWGRGDRIDSLSDQVLLLEEKLGACSCEDNSLGPGLNSR
Download sequence
Identical sequences 13616.ENSMODP00000018630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]