SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000018657 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000018657
Domain Number 1 Region: 21-206,304-341
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.85e-59
Family Calnexin/calreticulin 0.0001
Further Details:      
 
Domain Number 2 Region: 178-308
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 3.79e-27
Family P-domain of calnexin/calreticulin 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000018657
Sequence length 388
Comment (Monodelphis domestica)
Sequence
MSRAKVPGPLWALWLMRAALATVYFQEEFLDGESWRNRWIPSTNDSKFGHFRLSSGKFYG
DIQKDKGLQTTENAKFYAISSRFKPFSNKGKTLVIQYTVKHEQKMDCGGGYIKIFPSELD
QKNLNGKSQYYIMFGPDICGFDIKKVHVILFYKNQYHSNKKPIRCKVDGFTHLYTLTLRP
DLTYEVKIDTDIIESGSIEEDWNLQKIRRMEKSALKMPENWDKLSQNDKPSDDWDKHLLD
ASANKPSDWNSELDGEWQPSVIQKPKHKDGLKLDNSDYKDVWLHKKIENPGYLQDFEFLE
YEDIGVIGLELWQVRSGTIFDNFLITDDENYAADFGLKTWGRTKDPEKEMDMIQAKEEIK
KAREEEEQLIRENIKEKYFQSQTAKDEL
Download sequence
Identical sequences 13616.ENSMODP00000018657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]