SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000019155 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000019155
Domain Number 1 Region: 7-71
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000017
Family Calponin-homology domain, CH-domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000019155
Sequence length 140
Comment (Monodelphis domestica)
Sequence
MEGDMDEEMLHQLYLWVDIPLSPTQLNLSRDFSDGVLAAEVVKFYFPKMVEMHNYVPANS
VQQKVNNWVHLNRKVLHKLNFSVPEDVIQKIAQCSPGVVELVLQPLRERLEERKRKRQGV
GSSQELGPQEGSSYMDMDTV
Download sequence
Identical sequences F6XEP3
ENSMODP00000019155 ENSMODP00000019155 13616.ENSMODP00000019155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]