SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000019652 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000019652
Domain Number 1 Region: 4-133
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.05e-51
Family Calponin-homology domain, CH-domain 0.00000035
Further Details:      
 
Domain Number 2 Region: 200-259
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 5.89e-21
Family EB1 dimerisation domain-like 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000019652
Sequence length 277
Comment (Monodelphis domestica)
Sequence
SWGMAVNVYSTSVTSENLSRHDMLAWVNDSLHLNYTKIEQLCSGAAYCQFMDMLFPGCVH
LRKVKFQAKLEHEYIHNFKVLQAAFKKMGVDKIIPVEKLVKGKFQDNFEFIQWFKKFFDA
NYDGKDYNPLLARQGQDVAPPPNPGDQIFNKPKKPIGTAGNVPQLGEGTWGAEPAGALQP
RNPPSTRNGGHEADAQILELNQQQLLDLKLTVDGLEKERDFYFSKLRDIELICQEHESDN
SPVISGIIGILYATEEGFAPPEDDEIEEHQQEDQDEY
Download sequence
Identical sequences F7AH31
ENSMODP00000019652 ENSMODP00000019652 13616.ENSMODP00000019652

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]