SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000020036 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000020036
Domain Number 1 Region: 275-428
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.21e-48
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000077
Further Details:      
 
Domain Number 2 Region: 431-596
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.6e-44
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000149
Further Details:      
 
Domain Number 3 Region: 148-266
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.84e-34
Family Spermadhesin, CUB domain 0.0000187
Further Details:      
 
Domain Number 4 Region: 36-142
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-33
Family Spermadhesin, CUB domain 0.00024
Further Details:      
 
Domain Number 5 Region: 641-793
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.39e-24
Family MAM domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000020036
Sequence length 934
Comment (Monodelphis domestica)
Sequence
MDTFHLLWVSLALSFSGPGVTGEAGLPCGGRLNSKDAGYITSPGYPQDYPSHQNCEWIVY
APEPNQKIVLNFNPHFEIEKHDCKYDFIEIRDGDSESADLLGKHCGNIAPPTIISSGSVL
YIKFTSDYARQGAGFSLRYEIFKTGSEDCSRNFTSMNGTIESPGFPDKYPHNLDCTFTIL
AKPKMEIILQFMTFDLEHDPLQVGEGDCKYDWLDIWDGIPHVGPLIGKYCGTKTPSKLRS
STGILSLTFHTDMAVAKDGFSAHYYLIPQETPENFQCNVPLGMESGRISNEQISASSTYS
DGRWTPQQGRLHSDNNGWTPNVDSNKEYLQVDLRFLTILTAIATQGAISRETQNGYYVKS
YKLEVSTNGEDWMMYRHGKNHKVFQANNDATEVVLNKIHTSVLTRFIRIRPQTWHTGIAL
RLELFGCRITDAPCSNMLGMLSGLISDSQITASSTREYLWSPGVARLVSSRSGWFPRIPQ
AQPGEEWLQVDLGVPKTVKGVIIQGARGGDTITAVEARAFVRKFKVSYSLNGKDWEYIED
PRTQQPKLFEGNMHYDTPDIRVFDPVPAQYVRVYPERWSPAGIGMRLEILGCDWTDTRPT
VETLRPTLKNEETTTQYPTDEETTDCGENCSAEEDKDFQPPPGFNCNFDFMEESCGWMYD
HEKWLTSTWTGSSSPVDNAPPDGRTYLRLQSNGRREDQHGRLISPALYLPRSPVCMEFQY
QATGGSGIALQVVRKASQASKLLWVIREDQGSEWRQGRIILPSDEMEYQIVFEGILGKGR
SGEIAIDDIRIGTDIPLENCMEPITAFPGENFSVDIPEIPRIINSERYEDDDEDEYEVDW
SNTSSPTTGPGLPKEDREKSWLYTLDPILVTIIAMSSLGVLLGAICAGLLLYCTCSYTGL
SSRSCTTLENYNFELYDGIKHKVKINHQKCCSEA
Download sequence
Identical sequences XP_007501938.1.35504 13616.ENSMODP00000020036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]