SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000020549 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000020549
Domain Number 1 Region: 590-774
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.66e-60
Family SPRY domain 0.0000034
Further Details:      
 
Domain Number 2 Region: 3-90
Classification Level Classification E-value
Superfamily DEATH domain 3.77e-21
Family Pyrin domain, PYD 0.0029
Further Details:      
 
Domain Number 3 Region: 364-427
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 9.92e-17
Family B-box zinc-binding domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000020549
Sequence length 775
Comment (Monodelphis domestica)
Sequence
MAKTLSDHLLHTLESLVAYDLEKFKFKLQTANLDKDQVRIPHGRLQNATGPVKLADLLIN
YYGERYAVKLTLQVLQAINQNLLVEELSQAITPECLTQECATEISGISAFSRTTGSKTLE
ITVPLKGILENEDANFQGPNEDIMDGIQVPISSSQLHAGQEYQEDSPETDASLVLESNRY
ENSEGFVTFGKKAYRNQAPLFLSAKRIPNQEFDDFSGEQNHPNQKSMNKEHGNSEVSVSL
GETTILYKDQVPESPKEKIFGNVDTSMLSGEKGTKDPGNWYLKEAHEGIFHNIYFKPYKY
YSSCSICQAMVVNPSKISWGNHIRSHYNVGHNVCLKCQAMFPKNFQHSRSLENIPTDYRG
PKLNPQSMPQCECHPKQLQRLFCKDHGKTICLICSMSPEHRGHRMLPIEEAAQSYKEQIQ
NQLEHLKKVRETAEEKKSQGNKTITAFLNKTETQKMQIMSQLKELHDFLEKQERLFLVWL
EELSKTIFRSKEDYITKASQEISLLEELMGELEEKQKQPAWEFLQVKMSDSLYGEVAEWA
FLPEEWALSPELKEKTHLLFWKSQSVERSMRQFIASLQSEMETFKILQLREVQLYSANVT
LDPETAHPKLIISDDRKHVRLGKKCGKVFDGPQRFNDSVIVLGYPSFTSGKQYWQVDVGD
KTSWILGVCKNSVNRKGSTAFSPGNGYWLVMMMKKNEYSASTIPPTPLSLKEPPRCVGIF
MDFEAGDISFYNVTARSHIYTFSFSSSSSGPLRPVFSPGIQDRGKNADPLTICSV
Download sequence
Identical sequences 13616.ENSMODP00000020549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]