SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000021403 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000021403
Domain Number 1 Region: 291-474
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.69e-69
Family SPRY domain 0.00000262
Further Details:      
 
Domain Number 2 Region: 9-114
Classification Level Classification E-value
Superfamily Immunoglobulin 3.93e-18
Family V set domains (antibody variable domain-like) 0.0018
Further Details:      
 
Domain Number 3 Region: 124-202
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000281
Family C1 set domains (antibody constant domain-like) 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000021403
Sequence length 538
Comment (Monodelphis domestica)
Sequence
GKIGKRNLVLLGTKAELRCPLSLWMVPESIEVKWLRTQKSSSAQTVHVYRNGQDFYGEQM
PQYKGRTALVRDNQEDNFILEIYNVQLEDQGQYYCQIQAGILSKNATVKLEVAALGLDPY
IHMKSYEDGQIQLVCRSLGWFPKPQIQWRDTHGEILPSETQYLEKEGLFQMETSISLRNV
SPGNMTCSIWNAALDQEKKTTLFIAAFSHLHVAPSTVGLVVILPILGLLIALGIYIIWKQ
RRAREKLLYQQVVEIENLLSDHGKEKGRLHKGLKKHRAELKLKRSAANAGWRRAKLHPVD
VTLDPDTAHPKLLLSEDLRSVRLGDKRQDVPDSPKRFDFVVSVLGSPSFTSGCHYWEVCV
ADKTKWILGVCSEAVTRKGKITASPSNGHWLLRQSRMNEYEALTSPQTCFHLKESPRRVG
IFLDYEAGLVSFYNATNKSHIYTFTHAFSGPLRPFFEPCLHDEGKNVAPLIICSASQSSE
EFLDSNLSPETPQNEKQISGIGNGSIPLKSNLYPLQDIISSWPSDVPPALQGLRAPSF
Download sequence
Identical sequences 13616.ENSMODP00000021403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]