SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000022067 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000022067
Domain Number 1 Region: 1-93
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.65e-34
Family Ubiquitin-related 0.0000218
Further Details:      
 
Domain Number 2 Region: 100-154
Classification Level Classification E-value
Superfamily Zn-binding ribosomal proteins 1.83e-19
Family Ribosomal protein S27a 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000022067
Sequence length 156
Comment (Monodelphis domestica)
Sequence
MQIFIKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSAYN
IQKESTLHLVLRLRGSAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISCLRRE
CPSDECGAGIFMASYFDRHYCGKCCLTYYFNKPEDK
Download sequence
Identical sequences F7FV67
13616.ENSMODP00000022067 ENSMODP00000022067 ENSMODP00000022067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]