SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000022293 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000022293
Domain Number 1 Region: 1572-1757
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.4e-34
Family Laminin G-like module 0.00039
Further Details:      
 
Domain Number 2 Region: 1392-1569
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.11e-34
Family Laminin G-like module 0.0015
Further Details:      
 
Domain Number 3 Region: 985-1166
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.46e-23
Family Laminin G-like module 0.0023
Further Details:      
 
Domain Number 4 Region: 1162-1340
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.08e-21
Family Laminin G-like module 0.016
Further Details:      
 
Domain Number 5 Region: 769-965
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.06e-17
Family Laminin G-like module 0.013
Further Details:      
 
Domain Number 6 Region: 123-178
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000753
Family Laminin-type module 0.0026
Further Details:      
 
Domain Number 7 Region: 80-125
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000586
Family Laminin-type module 0.037
Further Details:      
 
Domain Number 8 Region: 18-59
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000247
Family Laminin-type module 0.014
Further Details:      
 
Weak hits

Sequence:  13616.ENSMODP00000022293
Domain Number - Region: 589-738
Classification Level Classification E-value
Superfamily Tropomyosin 0.0111
Family Tropomyosin 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000022293
Sequence length 1758
Comment (Monodelphis domestica)
Sequence
QSCGTGFFHSVSGECLPCDCNGNSNECLDGSGFCVNCQRNTTGEHCEKCPDGYIADVIRG
VPRFCQPCPCPLPHMANFAVSCYRKSGVIRCICKEKYAGPNCERCAPGYYGNPLLIGSTC
KKCDCSGNSDPNLIFEDCDEVTGQCRNCLRNTTGFKCERCAPGYYGDARIAKNCAVCNCG
GGPCDSETGECLEESFEPPTGMDCPTISCDKCIWDLTDDLRLAALAIDESKSNLLSVSSG
VAAHRHVNEINSTVYLLKAKFSERENQYILRKIQISDAENTMKGLQSDLEELAEKENQAA
KKSQLVQQETMDTINYATQLVEDAHNMRDKIQEISSKMLYYGVKQDLGPEEISEKLVLAE
NMLEELRHRKPFLTQRDLVDEEADEAQELLSLAENWQRLHNDTRSLFPVVLEQLDDYDAK
LSELQESLDESLDRARDAEDMNRANAAKQRDNEKQHERVKEQVAMVNISLSESAESLETP
RLTISELSDIIQNASGIYAEIDGAKKELQDKFSNLTTLDHDLVQRAMEHAEDLQQQADEL
NRSLHRLDTNGLVQKALDASNVYENIINYVHEANESAVLALSITDRVSDAVGGIDTQITY
HKDESENLLSQAKTLQATADSSNEQAVADTSQRVGGALARKSFLKNRLNEAIKKLQAAER
GDAERRLDHSKRIIAEAEKTTMEVGQATTPMVNNLNTWSQSLHHFDSSAYNTAVDSARDA
VRNLTEVVPQLLDQLRTVEQKRPASNVSDSIRRIRELIAQTRSVASKIQVSMMFDGQSAV
EVNTKTNVDDLKAFTSMSLYMKPPEKSAGKNENADRFILYLGSKNAKSDYMGLAIKNDNL
VYIYNLGNKDVEIPLDSKPVSSWPAYFSIVKIERVGKHGKVFLTVPSLSSTAEEKFIKKG
EVSGDDSLLDLQPEDTVFYVGGVPPNFKLPASLNLPGFVGYLELATLNNEVISLYNFKHI
YNMDPSKSIPSARDKLAFTQSRAASYFFDGSSYAVVRDITRRGKFGQVTRFDIEVRTPVA
NGLVLLMVNGSTFFSLEMRNGYLNVFYDFGFSNGPVHLEDSQKKAPINDAKYHEISIIYH
NDKKMILVVDRRHVKSMDNEKMKIPFTDIYIGGVPPEVFQSSNIKAHLPLDVNFRGCMKG
FQFQKKDFNLLEQPETLGVGYGCPEDSLISRRAYFNGQGFIASSQKISFFDAFEGGFNFR
TLQPNGLLLYYAAGSDIFSISMDKGTVILNVKGIKVQTTDKQYDDGQSHFIIASISPTRY
ELIVDKDKLGKNNPTKGKTEQTPVSESKFYFGGSPISSQYANFTGCISNAYFTRLDRDVE
VEDFQRYSEKVHTSLYECPIESAPVSLLHKKGKNSSKPKVNKNKKNEKNKDSPRDPVGLK
SLKQNISRDSHCQLSSSPKAIAHAYQYGGTANSRQEFEHLKGNFAEKSQFSIRLKTRSSH
GMIFYVSDQEENDFMTLFVAHGRLVFMFNVGHRKLKLRSQEKYNDGLWHDVIFIREKNSG
RLIIDGLRVLEESFPPTGTAWKVEGPIYLGGVAPGKAVKNVQINSVYSFSGCLSNLQLNG
TSITTASQTFSVTPCFEGPMESGTYFSAEGGYVILDESFNIGLKFEIAFEVRPRSSSGIL
VHGHSVNGEYLNVHMKNGQVIAKVNNGIRDFSTSVTPKQSLCDGRWHRITVIRDSNVVQL
DVDSEVNHVVGPLNPKSVDHREPVFVGGVPESLLTPSLTAIRPFTGCLRNFVIDERPVSF
SKAALVSGAVSINSCPAA
Download sequence
Identical sequences 13616.ENSMODP00000022293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]