SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000022397 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000022397
Domain Number 1 Region: 4-244
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 9.05e-72
Family Calponin-homology domain, CH-domain 0.0000133
Further Details:      
 
Domain Number 2 Region: 2676-2830
Classification Level Classification E-value
Superfamily Spectrin repeat 1.7e-26
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 3 Region: 264-386
Classification Level Classification E-value
Superfamily Spectrin repeat 1.01e-25
Family Spectrin repeat 0.0005
Further Details:      
 
Domain Number 4 Region: 1197-1349
Classification Level Classification E-value
Superfamily Spectrin repeat 1.83e-25
Family Spectrin repeat 0.00058
Further Details:      
 
Domain Number 5 Region: 1423-1561
Classification Level Classification E-value
Superfamily Spectrin repeat 3e-25
Family Spectrin repeat 0.00086
Further Details:      
 
Domain Number 6 Region: 2783-2923
Classification Level Classification E-value
Superfamily Spectrin repeat 2.62e-24
Family Spectrin repeat 0.0003
Further Details:      
 
Domain Number 7 Region: 2570-2715
Classification Level Classification E-value
Superfamily Spectrin repeat 4.66e-24
Family Spectrin repeat 0.0004
Further Details:      
 
Domain Number 8 Region: 1645-1771
Classification Level Classification E-value
Superfamily Spectrin repeat 1.31e-23
Family Spectrin repeat 0.00082
Further Details:      
 
Domain Number 9 Region: 2254-2396
Classification Level Classification E-value
Superfamily Spectrin repeat 1.92e-23
Family Spectrin repeat 0.0019
Further Details:      
 
Domain Number 10 Region: 2359-2507
Classification Level Classification E-value
Superfamily Spectrin repeat 3.27e-23
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 11 Region: 2058-2193
Classification Level Classification E-value
Superfamily Spectrin repeat 3.12e-22
Family Spectrin repeat 0.00075
Further Details:      
 
Domain Number 12 Region: 3210-3358
Classification Level Classification E-value
Superfamily Spectrin repeat 5e-20
Family Spectrin repeat 0.0028
Further Details:      
 
Domain Number 13 Region: 821-961
Classification Level Classification E-value
Superfamily Spectrin repeat 4.24e-19
Family Spectrin repeat 0.0039
Further Details:      
 
Domain Number 14 Region: 663-776
Classification Level Classification E-value
Superfamily Spectrin repeat 9.1e-19
Family Spectrin repeat 0.0012
Further Details:      
 
Domain Number 15 Region: 1558-1673
Classification Level Classification E-value
Superfamily Spectrin repeat 3.8e-17
Family Spectrin repeat 0.00046
Further Details:      
 
Domain Number 16 Region: 3101-3230
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000119
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 17 Region: 555-670
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000072
Family Spectrin repeat 0.002
Further Details:      
 
Domain Number 18 Region: 1877-1992
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000276
Family Spectrin repeat 0.0033
Further Details:      
 
Domain Number 19 Region: 383-495
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000196
Family Spectrin repeat 0.00088
Further Details:      
 
Domain Number 20 Region: 1783-1883
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000236
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 21 Region: 3363-3423
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000082
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 22 Region: 1359-1456
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000245
Family Spectrin repeat 0.0019
Further Details:      
 
Domain Number 23 Region: 1990-2083
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000216
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 24 Region: 2521-2585
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000633
Family Spectrin repeat 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000022397
Sequence length 3424
Comment (Monodelphis domestica)
Sequence
MDSEYEQGHVHKLKAQHMRMQEKTFTNWVNNVFHHGKAGIKIQNMYLELGNGIHLLKLLE
LISGEVLPPPNRGRMRVHFLENNSRALAFVRSKVSVPLIGPENIVDGDQALILGLIWVII
LRFQISHISLDKEEFGASAAQLSAKEALLVWCQRKTAGYPNVNITDFSQSWSDGLGFNAL
IHAHRPDLVRYSSLQPSKPLYNLENAFEVAHRDLGISRLLDPEDVAVPRPEECSIMTYVS
LYYHCFSHLHQGQTVQKRLAKILQQLQETAALQARYEQLVSELLAWIAEQKARLEERHFP
DTLSATRRLLAAFAAFRKDEKPRGLEQRGTAEALLFHLNATLQAQNRRPFLPPEGLGPGE
LGRCWAALERAESCREQALQKQLLRLERLETLARRFLRKAALRESFLVDTEQVLNQLGAP
VPSSALLAAAIQKLGTLEAEVLPQEGRFLALAEIASFLEQERYHGWAEVARRQKELSQRW
ERLLGELQERKEHLANSGVALGLLQEVDAATEELKEVQVLANSPAYGLPLAEVVELLQRH
ELLEAHVSSQSALVSHLIERTAQLSSITSAPLDGLQIRTWGLSQVYQSLILLVRARKALL
DQALQQAEFLNSCDEEESWLQEKRQVTQAATLGRDLSHITAALWKYKALETEICSHQAVC
VEITRKARELSLQWHPGQPDPQERAEAIHSQWQHLRDTTAKLLARLQAALFIKQYFADVS
EVQSWLQEQRSLLANEDYGKDEAGVMVLLQRHQRLEREMWACGLELRRLEEQAQTAAHQA
PLLKVALLMSPLCKRPRNQGSRQRSSWRSVRWGTQEITSPLEPDLHFDPETIHKTQGQLN
QEYQDLQALAQHRRRRLEEMSTLFCFYDSCGELQSWLEDQTVLFQTLKPQPENVEADKHK
FENFLIALAVGKGHLAEIRSSAEKLRQRNPDHAARIQQWQQELGQRWEQLEALKEEKGFH
LASMADVHSFLQECGPTQTQLQDVGVKLEAMMPAGSTGSCHHSLQSIQHEILVLERKICY
LISVVTKVVVGVLRRRGRDWCRGQVGQPYGQEGLGSGPASQTHYLHITSKQVILSTVSPS
CPPPIFSDFQNALDNILFYSHNNPMRKAVEEPVRLNDLLKAIQLISGRAGAQIQVLDPKL
HQASVMGVEGGIDFDYLPSWDLEVALCLYPQEDVSDVQNLLQQHQEFNQLLQTLGPRAEN
LRSHGKKLTENFHFASHMIRERIASSQNRWTKLQEMSEQRKRQLLASLQLQKWNRDVAEM
MLWMEEKCLMAADESSREPGVILRKLKRHEATESEVLANGAMVEQLQQLGIKLLDTEHHA
REETRAKLQDLDKTWKELNHKMAAHGDELRQAGQQAQLLELLQEAKEKMEQMERGLQSAE
TGQDLHSSRELQRKQKQLESESQQLAEKMSTIVTHAQSVAANRFDSQTILDETQKYLQRF
QALQGPLAARRQQLRASVELYQFYHLQGLEITWVKERLPSASSVVYGQSLDAAQRLLYKH
KELQAEVKAHQSQMQKVLASGQSLAACGHPSALDITERCQDLESCWLGLGEACQGRARQL
QHSVALYQYLLDVSDLEGLLGEKRPLVSSQDYGKDQLATVSLIKKHTVLEQELALYGSFV
AELVQTAQTFTSPGAPKELPVPPGQLQNQLQELQELATTRGRRLEEALRLHEFIQEAEEL
QGWLARQKQVVSSEEEPGEDYAHVRHLRAKHELFQHQVETGGRRVANCQQLAETLLEGQH
VANQEIHQRHQELRSTWAELWGLTQARGQSLTIAETTLKIQQDLTETIPSSQEKATSLPD
DLAQDRHGVQAQLRRHEELENELSGTEQQLQELLDKADEMQKLCWGARLEALQRQQEAVV
QSWETLRLRVERRRGELEQACLLTGFHTVVQEYSTWAAGVQRELQAKETSRDASSSHLQL
STHQDVRAELKAREEVYQQAVQLGQGLLLEEGAPAEEIQEKLGALREERQKVFQAWERKQ
EQLMSMHLEQQFRRDCDYLNKILTAQEVYLKTSTLESSVEGLERLIRRHEAFQKILDAQD
EKEAALQEQVKQLRGVRVCELLNLVRQRRMQVKERAKSHGEALHTTLLLASFTREVSEAE
DWIQERTQQLEKPSPWGAGDLKDKLKCLQKHQVFEAEVQAHGEIITHITEKGEALLAQSH
PQATEILEKQQSLQEHWHKLRQALLARGQGLEDKRDFLEFLQRVDQVEAWIRQKEVMVNV
GDLGQDYEHCLQLSRRLSEFQGTALWETVDDTHIKAINALSLQLKSRDPEEVKIIYQRRH
QLNERWNNFHGNLLRYQQQLEGALEMHAMVQELDNIMERIEEKSALLQAPNYGKDLGDVE
RLLRKHEELDREISVIQAQIEPLEQEVSRLCQRSPGAAQALINKHRELDSSWQRLQTQVK
QRREKLDSSYQVQKLYTMLQELLHWVRELKTQIEMGRLPSSPTEARQLMEEHQDLKAELS
ARAESIDQIRNTGKQLLEARHPMAPDICQALANFEHELTGLEESWQEHQLQLQQALDFQV
FLSSVEQIESWLNNKEIFLENDDLSNSLATMETLQWKHERFEKGLETQLEKINAMETMAL
NLNQSQHPEAHCIASKCQMVLSRKEKLLERIQVRRHHLEEFQQLQRFLQDSFEVSMWLGE
KNLVALDEGWRDPSTLQAQLQKHQSFQAELDASVAQLNRLQMEGEKLLKEGHPALVTIQK
QLQEIGGLWSQLQANCLKKGTKLQDAYKALHFQRKVEEVEKWLQNMEEELQAPLGGQDLA
GVKELLEAQGELEAAMEGQEGLVQSLMDQAHAFGCEGHFLAGEIEEQTQRLLQRYTNLRE
PLRERRGALESKSLLYQFFQDVEDELAWVQEKLPLASAQDHGTTLNAIQQLQEKHQNLED
EISNHEALAQVVLDTGHKLVQGDHFAASEVTTRLQHKTSQLEKELEASNRRADKAEKQNQ
SLTTRKENMKYLTEKVTDLENRGRRDLKIIGLPKKPEINKNLDAILQQGGKIEIERVHRT
PSILNPQKTTPSLKALANLQALRETHKGLLQKAKTREQGLKEQQNLYGLEREAQLLDTWL
AGRRATAESPDCGQDLEDVKVLEEKFHTFQREVQSLGPAKIQGFLELAGNLERAAPRCYP
EIQAQRSRIEDSWEQLNKTIRTRAENLVAAREVHGFNQAAAELWSWIQEKAAMLGQGDCG
QDLSSVQSLQRQQRNLELELVAMEKETNRLRAEASWLGRLYPTVQESLAQRLGEVQESWH
SLEKKAQHRGQQLQQAECGHMFLSHCRELLSLTQEMKRLVMLEEPSGDMPGAEQQLLQHE
ELGQDIEEHWLLVQDAQQEGEQLAGSGHFMAQEVKEWLQELGDQMQELQEEWAHRQSLYK
ENWELQKLRQDLEKADIWLSSREGLLLDPNLGNSVSDVEELLRKHQDLEKILATQEEKFD
QLQR
Download sequence
Identical sequences 13616.ENSMODP00000022397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]