SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000022485 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000022485
Domain Number 1 Region: 123-236
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.000000563
Family cAMP-binding domain 0.035
Further Details:      
 
Weak hits

Sequence:  13616.ENSMODP00000022485
Domain Number - Region: 62-117
Classification Level Classification E-value
Superfamily Taf5 N-terminal domain-like 0.00366
Family Taf5 N-terminal domain-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000022485
Sequence length 288
Comment (Monodelphis domestica)
Sequence
MGENASIWWNLLGEHPLCTAWKQEAEGSIYHLASILFIVGFMGGSGFFGLLYVFSLLGLG
FLCSSVWAWVDVCAADIFSWNFVLFVICFMQFVHVAYQVRSVTFDKEFQELYSSLFQPLG
ITLPVFRKIALCCQVVSLEKEHCYAMQGKTPIDKLSLLVSGRIRVTVDGEFLHYIFPLQF
LDSPEWDSLRPTEEGIFQVTLTAETDCRYVAWRRKKLYLLFAQHRFISRLFSVLIGSDIA
DKLYALNDRVNMGKGHRYDIRLPNFYQAATPEITRSPLIEHFRKNTRR
Download sequence
Identical sequences 13616.ENSMODP00000022485 XP_003340521.1.35504 XP_016286699.1.35504 XP_016286700.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]