SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000023020 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000023020
Domain Number 1 Region: 389-625
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.01e-37
Family Calponin-homology domain, CH-domain 0.0000901
Further Details:      
 
Domain Number 2 Region: 87-241,386-469
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.83e-20
Family FAD/NAD-linked reductases, N-terminal and central domains 0.072
Further Details:      
 
Domain Number 3 Region: 783-816
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000174
Family LIM domain 0.012
Further Details:      
 
Weak hits

Sequence:  13616.ENSMODP00000023020
Domain Number - Region: 817-845
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00713
Family LIM domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000023020
Sequence length 961
Comment (Monodelphis domestica)
Sequence
MEESRNEKMNEAHILFDRFVQASTCKGTLKAFQELCDYLELKPKDYRSFYHKLKSKLNYW
KAKALWAKLDKRGSHKDYRKGKVCTNTKCLIIGAGPCGLRTAIDLSLLGAKVVVIEKRDA
FSRNNVLHLWPFTIHDLRGLGAKKFYGKFCAGAIDHISIRQLQLILLKVALILGIEIHVN
VEFQGLVYPPEDQENERIGWRAQVHPKTHPVSEYEFEVIIGGDGRRNTLEGFRRKEFRGK
LAIAITANFINRHTTAEAKVEEISGVAFIFNQKFFQELREATGIDLENIVYYKDDTHYFV
MTAKKQSLLEKGVILHDYADTELLLSRENVDQEALLSYAREAADFSTNQQLPSLDFAINH
YGQPDVAMFDFTCMYASENAALVREQNGHQLLVALVGDSLLEPFWPMGTGIARGFLAAMD
SAWMVRSWSLGISPLEVLAERESIYRLLPQTTPENVSKNFSRYSIDPVTRYPNINVNFLR
PNQVLHLYDTGEMKDVHLEMENLVNSQVTPKLTRNESVARSSKLLGWCQRQTDGYAGVNV
TDLTMSWKSGLALCAIIHRYRPDLIDFDSLDEHNTEKNNQLAFDIAEKELGISPIMTGKE
MASVGEPDKLSMVMYLTQFYEMFKDSIPSSVTLDAEEKAVLIASTKSPISFLSKLGQSIS
RKRTPKDKKEKDLDGVGKRRKTSQSEEEEPPRGYREERPTLVSALTERRIDVAIGNQNKV
KSMATQLLAKFEENAPLQSTGSIRRQPIQERCISQPSRRQPEQGRPAPIPQWKQGSLKKE
FPQNIGGSDICYFCHKRVYVMERLSAEGKFFHRSCFKCEYCSTTLRLSCYAYDIEDGKFY
CKPHYCYRLSGYAQRKRPAAAPLSGKETKGPLQEGTTADRTGRSNSTTSSVERTPGSSVN
GLEEPSLAKRLKGTPERIELENYRLSMKQAEELEEVPEETLAEHNLSSVLDKGTEEDAAS
R
Download sequence
Identical sequences 13616.ENSMODP00000023020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]