SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000023082 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000023082
Domain Number 1 Region: 110-298
Classification Level Classification E-value
Superfamily vWA-like 1.63e-60
Family Integrin A (or I) domain 0.0000712
Further Details:      
 
Domain Number 2 Region: 1155-1358
Classification Level Classification E-value
Superfamily vWA-like 6.23e-57
Family Integrin A (or I) domain 0.00016
Further Details:      
 
Domain Number 3 Region: 410-597
Classification Level Classification E-value
Superfamily vWA-like 9.79e-57
Family Integrin A (or I) domain 0.00015
Further Details:      
 
Domain Number 4 Region: 2280-2485
Classification Level Classification E-value
Superfamily vWA-like 2.37e-56
Family Integrin A (or I) domain 0.00021
Further Details:      
 
Domain Number 5 Region: 2502-2705
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.46e-34
Family Laminin G-like module 0.032
Further Details:      
 
Domain Number 6 Region: 614-783
Classification Level Classification E-value
Superfamily Fibronectin type III 1.16e-22
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 7 Region: 1737-1908
Classification Level Classification E-value
Superfamily Fibronectin type III 1.79e-22
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 8 Region: 1921-2087
Classification Level Classification E-value
Superfamily Fibronectin type III 3.73e-22
Family Fibronectin type III 0.00096
Further Details:      
 
Domain Number 9 Region: 1548-1709
Classification Level Classification E-value
Superfamily Fibronectin type III 1.1e-21
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 10 Region: 1365-1452
Classification Level Classification E-value
Superfamily Fibronectin type III 1.41e-20
Family Fibronectin type III 0.00042
Further Details:      
 
Domain Number 11 Region: 792-881
Classification Level Classification E-value
Superfamily Fibronectin type III 2.67e-20
Family Fibronectin type III 0.00058
Further Details:      
 
Domain Number 12 Region: 981-1156
Classification Level Classification E-value
Superfamily Fibronectin type III 1.2e-19
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 13 Region: 2100-2185
Classification Level Classification E-value
Superfamily Fibronectin type III 7.69e-19
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 14 Region: 312-402
Classification Level Classification E-value
Superfamily Fibronectin type III 2.8e-18
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 15 Region: 889-973
Classification Level Classification E-value
Superfamily Fibronectin type III 1.8e-16
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 16 Region: 1451-1543
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000081
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 17 Region: 2190-2273
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000125
Family Fibronectin type III 0.002
Further Details:      
 
Domain Number 18 Region: 6-88
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000186
Family Fibronectin type III 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000023082
Sequence length 3101
Comment (Monodelphis domestica)
Sequence
ISFPVEPPSDLNFKIIDENTVHMSWAKPVDPIVGYRVTVDPTTDGPTKEFTLSASNTETL
LSDLIPEIEYVVTITSYDEVEESVPVIGQLTIQTGGPVDPKEKKPGQTEIQKCSLSAWTD
LVFLVDGSWSVGRNNFKYILDFIAALVSAFDVGEGKTRVGVVQYSSDTRTEFNLNQYYQR
KDLLAAIKKIPYKGGNTMTGDAIDYLIKNTFTESAGARVGFPKVAIIITDGKSQDEVEIP
ARELRNIGVEVFSLGIKAADAKELRQIASPPSLKHVFNVANFDAIVDIQNEIISQVCSGV
DEQLGELVSGEEVVEPPSNLIATDISSKYVKLSWDPSPSPITGYKVLLTPMIPGSKQQAL
SVGPQTTSLNVRDLSADTEYQISVYSMKGLTSSEPISIMEKTQPMKVQVECSRGVDIKAD
IVFLVDGSYSIGIANFVKVRAFLEVLVKSFEISPNRVQISLVQYSRDPHTEFTLKKFTRV
EDIIEAINTFPYRGGSTNTGKAMTYVREKIFVASKGSRSNVPKVMILITDGKSSDAFRDP
AIKLRNSDVEIFAVGVKDAVRSELEAIASPPPETHVFTVEDFDAFQRISFELTQSICLRI
EQELKVIKKKSYVPPRNLNFSDETSYSFKVNWSPAGEHVFTYHITYKEAPDGEAHTVVEP
ASSTSVVLDHLKPETLYLVNVTAEYEDGFSDPLTGEETTLEVKGAPRNLKVTDETTDSFK
IAWTQAPGKVLRYRIVYRSVPGGPRQEVTVPANERRKTLENLTPDTKYEVSVIPEYFSGP
GSPLTGNAATEEVRGNPRDLRVSDPTTSSMKLSWSAAPGKVKQYLVTYTPVAGGETREVT
VKGETTSTQLKGLDQGTKYSLSVTALYASGAGDALSGEGTTLEERGSARDLITKDITDTS
IGAYWTSAPGMVRGYRVTWRSLYDDVETGEKNVPGDAIHTVIENLQPETKYKISIFATYS
SGEGNPLIGEATTDLSQKARTLRVDDETETTMRVTWQPAPGKVVNYRVVYRPRGGGRQMV
AKVPPTVTSTVLKRLQPQTTYDITVLPIYKTGEGKHRQGSGTTLSKFKMPRNLKTSDSTM
SSFRVTWEPAPGEVKGYKVTFHPTGDDQRLGELVVGPYDNTVVLEELRAGTTYKVNVFGM
FDGGESSPLIGQEMTTLSDTTVMPFLSKGMECFTRAEADIVLLVDGSWSIGRANFKTIRS
FISRIVEVFEIGPKRVQIALAQYSGDPRTEWQLNAHKDRRSLLDSVANLPYKGGNTLTGM
ALNFIRQNNFRPQAGMRPRARKIGVLITDGKSQDDVEAPSKKLKDDGVELFAIGIKNADE
SELKMIATDPDDTHAYNVADFDSLSRIVDDLTVNLCNSVKGPGDLEAPSNLVISEVTHRS
FRVSWTPPSDSVDRYKVEYYPVSGGKRQEFYVSRLETSTVLKDLKPETEYVVNVYSVVED
ENSEPLKGTETTLPVPVVSLNIFDVGPTNMRVQWQSIGGATGYLLSYKAVNATVPTTPKE
MRVGSSVTDMQLVDLIPNTEYTVTVQAALYDLTSDPATAREVTLPLPRPRGLKLTDVTHS
SMNVIWDPAPGKVRKYIVSYKTEEDDDVKQVEVDRSRTKTSLGDLISQTLYTVNVVAVYD
EGESPPVTAQETTRPVPAPINLRLTEVTPDSFRGTWDHGASDVSLYRVTWSPYGATEKME
TILNGDENTLVFENLNPNTLYEVSVTAIYPDESESDDLTSSERTLPEIPVTTLAPKSGPR
NLQVYNATSKSLTVKWDPASGRVQKYRITYQPSTGDGPEQTTTIGGRQNSVVLQKLKPDT
PYSITVSSLYSDGEGGRMTGRGKTKPLNTVKNLRVYDPSTSTLNVRWDHAEGNPRQYKVF
YAPTAGGLEEMVTTPGNTNYVILRNLQPDTLYTVTVVPVYTEGDGGPTADTGKTLVRGLA
RNVQVYNPTPNTLDVRWEPAPGPVQQYRIVYSPQTGTRPSESITVPGNTRTVHLERLTPD
TPYSVNIVAVYSDGEGNPSPSQGQTLPRGGPRNMKVFGETTNSLSISWDHADGPVQHYRI
IYSPTVGDPIDEYTTVPGRRNNAILQPLQTDTPYKITIVAVYEDGDGGHLVGNGRTVGLL
PPQNIHITDEWYTRFRVSWDPSPSPVLGYKIIYKPVGSNEPMEVFVGEVTSYTLHNLNPS
TTYDVNVYAQYDSGLSVPLTDQGTTLYLNVTDLTTYQVGWNTFCVKWTAHRAATSYRLKL
NPSDGTRGQEITVRGSETSHCFKDLSPDTDYGVTVFVQTPNLEGPGVSVKEHTAVKPTEA
PTEPPTPPPPPTIPPARDVCKGAKADIVFLTDASWSIGDDNFNKVVKFIFNTVGAFDLIS
PAGIQVSFVQYSDEVKSEFKLNTYADKAQALGALQNIRYRGGNTRTGKALTFIKEKVLTW
ESGMRKAVPKVLVVVTDGRSQDEVKKAALVIQQSGFSVFVVGVADVDYNELANIASKPSE
RHVFIVDDFESFEKIEDNLITFVCETATSSCPLIYLDGYTSPGFKMLEAYNLTEKNFATV
PGVSLESGSFPSYTAYRLQKNAFVNQPTVDLHPDGLPPSYTIILLFRLLPESPSDPFAIW
QITDRDYKPQVGVVADPSSKTLSFFNKDMRGEVQTVTFDTDEVKSLFYGSFHKVHIVVTS
KSVKLYIDCYEIIEKDIKEAGNITTDGYEILGKLIKGERKSAAFQIQNFDIVCSPVWTSR
DRCCDIPSRRDEAKCPAFPNACTCSQDSVGPPGPPGPAGGPGAKGPRGERGINGAIGPPG
PRGDSGPPGPQGPPGPQGPNGLSIPGEQGRQGVKGDTGEPGLPGRSGSPGLPGPPGPMGP
PGDRGFTGKDGAMGPRGPPGPPGSPGSPGVTGPSGKPGKPGDHGRPGPSGLKGEKGDRGD
IASQNMMRAVARQVCEQLISGQMNRFNQMLNQIPNDYHSNRNQPGPPGPPGPPGSAGARG
EPGPGGRPGFPGTPGLQGPPGDRGLPGEKGERGIGSQGPRGLPGPPGPQGESRMGPPGST
GSRGPPGPPGRPGNSGIRGPIGPPGYCDSSQCASIPYNGQGYPEPYVPESGPYLPEREPF
IVPMEPETTADEYEDYGADMPSEGYPPQMRQKRSLSRKPRK
Download sequence
Identical sequences 13616.ENSMODP00000023082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]