SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000023326 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000023326
Domain Number 1 Region: 60-181
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.47e-29
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000332
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000023326
Sequence length 349
Comment (Monodelphis domestica)
Sequence
MEQEKYLPELMAEKDSLDPSFVHATRLLAEEIEKFQGSEGKKDDEEKKYLDVISNKNIKL
SERVLIPVKQYPKFNFVGKLLGPRGNSLKRLQEETGAKMSILGKGSMRDKTKEEELRKSG
EAKYAHLSDELHVLIEVFAPPGEAYSRMSHALEEIKKFLVPDYNDEIRQEQLRELSYLNG
SEDSSRGRGIRGRGIRVPPTAPSRGRGGAIPPPPPPGRGVPAPRGTTVTRGALPVPPVAR
GVPTPRARGAPAVPGYRPPPPPAHEAYEEYGYDDGYGGEYDDQSYEAYDSSYATQTQSVP
EYYDYGHGTSEDTYDSYAQEEWAPTRSSLKAPPPRAARGGYREHPYGRY
Download sequence
Identical sequences F7FCC7
13616.ENSMODP00000023326 XP_001364980.1.35504 ENSMODP00000023326 ENSMODP00000023326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]