SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000023552 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000023552
Domain Number 1 Region: 938-1048
Classification Level Classification E-value
Superfamily Cadherin-like 3.43e-32
Family Cadherin 0.00035
Further Details:      
 
Domain Number 2 Region: 417-546
Classification Level Classification E-value
Superfamily Cadherin-like 1.14e-31
Family Cadherin 0.00077
Further Details:      
 
Domain Number 3 Region: 1457-1568
Classification Level Classification E-value
Superfamily Cadherin-like 5.42e-29
Family Cadherin 0.00054
Further Details:      
 
Domain Number 4 Region: 208-331
Classification Level Classification E-value
Superfamily Cadherin-like 6.42e-29
Family Cadherin 0.00069
Further Details:      
 
Domain Number 5 Region: 2192-2394
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.77e-29
Family Laminin G-like module 0.0054
Further Details:      
 
Domain Number 6 Region: 1668-1787
Classification Level Classification E-value
Superfamily Cadherin-like 1.18e-27
Family Cadherin 0.00078
Further Details:      
 
Domain Number 7 Region: 1358-1469
Classification Level Classification E-value
Superfamily Cadherin-like 3.85e-27
Family Cadherin 0.00096
Further Details:      
 
Domain Number 8 Region: 110-219
Classification Level Classification E-value
Superfamily Cadherin-like 7.42e-27
Family Cadherin 0.00072
Further Details:      
 
Domain Number 9 Region: 319-421
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-26
Family Cadherin 0.001
Further Details:      
 
Domain Number 10 Region: 627-733
Classification Level Classification E-value
Superfamily Cadherin-like 1.23e-25
Family Cadherin 0.00035
Further Details:      
 
Domain Number 11 Region: 528-639
Classification Level Classification E-value
Superfamily Cadherin-like 2.57e-25
Family Cadherin 0.0019
Further Details:      
 
Domain Number 12 Region: 2464-2625
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.59e-24
Family Laminin G-like module 0.0013
Further Details:      
 
Domain Number 13 Region: 8-108
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-24
Family Cadherin 0.00064
Further Details:      
 
Domain Number 14 Region: 1252-1355
Classification Level Classification E-value
Superfamily Cadherin-like 2e-22
Family Cadherin 0.001
Further Details:      
 
Domain Number 15 Region: 729-839
Classification Level Classification E-value
Superfamily Cadherin-like 2.86e-22
Family Cadherin 0.0028
Further Details:      
 
Domain Number 16 Region: 1141-1250
Classification Level Classification E-value
Superfamily Cadherin-like 3.28e-22
Family Cadherin 0.0018
Further Details:      
 
Domain Number 17 Region: 1042-1147
Classification Level Classification E-value
Superfamily Cadherin-like 1.1e-21
Family Cadherin 0.00092
Further Details:      
 
Domain Number 18 Region: 1773-1895
Classification Level Classification E-value
Superfamily Cadherin-like 2.28e-20
Family Cadherin 0.0012
Further Details:      
 
Domain Number 19 Region: 1567-1672
Classification Level Classification E-value
Superfamily Cadherin-like 7.14e-20
Family Cadherin 0.0023
Further Details:      
 
Domain Number 20 Region: 839-944
Classification Level Classification E-value
Superfamily Cadherin-like 1.07e-17
Family Cadherin 0.0039
Further Details:      
 
Domain Number 21 Region: 2079-2092,2123-2215
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000675
Family Growth factor receptor domain 0.0082
Further Details:      
 
Domain Number 22 Region: 2649-2687
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000134
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  13616.ENSMODP00000023552
Domain Number - Region: 1883-1974
Classification Level Classification E-value
Superfamily Cadherin-like 0.001
Family Cadherin 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000023552
Sequence length 3201
Comment (Monodelphis domestica)
Sequence
VEITLQDINDNPPVFPTDTLDLTVEENIGDGSRIMQLTAMDADEGANALVTYAIISGADD
SFHIDPESGELIATKRLDRERRSKYSLLVRADDGLQSSDMRINITISDVNDHIPKFSRPV
YSFDIPEDTTPGSLVAAILATDDDSGVNGEITYTVSEDDEDGIFFLNPVTGVFNLTRSLD
YETQQYYILTAHAEDGGGQFMTIRVYFNILDVNDNPPVFSLTSYSTSLMENLPLGSTILI
FNVTDADDGPNSQLSYSITSGDSLGQFTVDKNGVLKVRQTLDRESQSFYNLVIQVHDMPL
PSASSYTSTAQVSIILLDVNDNAPTFISPKLTYVPENTPTDTVVFKAQATDRDSGPNSYI
EYTLLNPLGNKFSIGTIDGEVRLTGELDREEVSNYTLTIVATDKGQPALSSSTEVAVIIL
DINDNNPIFAQALYKVEIDENTLTGTDIVQVYAADGDEGTNGQVRYSLLRGNENHEFRMD
SVTGILSVAKPLDREKKAAYSLTVQSVDRGSSPRMDTTTVEIILLDINDFVPVFELSPYS
INVPENLGTLPKTILQVVARDDDQGPNSKLTYMLIGGNEDNAFILSASGELKVIQSLDRE
TKEKCILLITATDSGSPALTGTGTVNVIVDDVNDNIPTFAHKMYSATISEDAPTGSDVLL
VNASDADASTNAVIRLIGGNSQFTINPSTGQIITSALLDRETKENYTLIVVSSDGGFPEP
LSSSTSVSVTVTDVNDNPPRFQHHPYVTHIPSPTPSGSFVFSVTVTDPDTGPNSELHYSL
TGRNSEKFHIDPLRGAIMAAELLNIATEMTFFVHVKDSGLSPKMDSTTVTVRFGNKADFP
KIRAKQQTFLFPESQPIGTLITTISGSSSRGEPLSYFIASGNLGGAFHIDQLTGQVSISQ
HLDFEMVQKYVVWIEARDTGFPPFSSYEKLAIAVMDVNDNSPIFKEDPFVAEILENLSPR
TLLTVSAMDKDSGPNGQLEYSIVNGNIENSFSIHHSTGEIKSIRSLDREKVSQYVLTVRA
SDKGTPSQSTTVTVIINVLDENDNAPRFSQIFTAPVPENAPLGYTVTRVTTSDEDVGVNA
ISRYSIIDTSLPFSINPSTGDIIISRPLNREDTDRYRIRVSAHDSGWTVSTDVAIFVTDV
NDNAPRFKKPSYYLDCPELTEIGAKVAQVSATDPDEGSNGQVFYFIKSQSEFFRINATTG
EIYNKQALKYRNVTGSSNVNINRHSFIVTSSDRGSPSLLSETTVTINIVDSNDNAPQFLN
SKYFTPVTKNVRVGTKLIKVTAVDDKDFGANSEVEYFISNESPVEKFKLDSTTGWISVAS
SLMSNLNQNFMMTVTARDKGNPPLSSQATVQIVVTEENYHSPEFSQSHMSTTVPESQSVG
SVVRTVSARDRDAAMNGLLTYHISSGNEDGLFAINASTGALILAKPLDYELHQKHEMTIS
ATDGGWVARTSYCSIIINVLDVNDNSPVFVPEEYSPTVLENAPSGTTVMRLNATDADSGS
NAVIAYSLQSSDSDLFVIDPNSGIITTQGFLDYETKQSYHLTVKAFNVPDEERCSFATVN
IHLKGTNEYVPRFVSKLYYFEISEAASKGSVVGEVFASDRDMGTDGEVHYLIFGTSRKKG
FQINSRTGQIYVSGVLDREKEERISLKVLAKNSGSIRGADVDEVTVNITILDANDPPVFS
LEIYNVQISEGVPIGTHVTFVSAFDSDSVPNWSRFSYFIGSGNENGAFSINPQTGQITVT
AELDRETLPVYNLTVLAVDLGTPSATGSASLLVTLEDINDNGPTLSIREGEVMENKRAGT
LVMTLHSTDPDLPPNQGPFTYYLLSTGPATSYFSLSTAGVLSTTREIDREQIGDFYLSVI
TRDSGIPQMSSTGTVHIRVIDQNDNPSEPRTVEIFVHYFSNLFPGGILGSVKPQDPDVLD
SFHCSLTSGVTSLFSIPSGTCDLNSQARSADGTFDLTVLSNDGLHSAVTSNIRVFFAGFT
NATVDNSILLRLSVPTMRDFLTNHYLHFLRIASSQLTGLGTAVQLYGAYEENNKTFLLAA
VKRNTNQYVNPSGVATFFESIKEILLRQSGVRVESVDHDPCIHGPCQNGGSCLRRLAVSP
TLKSHESLPVIIVTNEPLQPFFCKCLPGYSGNWCETDIDECLPSPCHNGGTCHNLVGGFS
CSCPEGFTGRACERDINECLPNPCKNGALCQNFPGSFNCVCKAGFTGVFGKHCELNSYGF
EELSYMEFPSLDPNNNYIYAKFATIKSHALLLYNYDNQTGERAEFLALEIAEERLRFSYN
IGSGTYKLTTMKKVSDGHFHTVIARRAGMAASLTVDSCSEDQEPGYCTVSTMAVSDDWTL
DVQPNRVMIGGIRSLDPVLQRRGQVESYDFVGCIMEFAINGRPLEPSQALAAHGILDRYA
GVFLFSMKEKQKEEKLLCSTMTPDTALSLEGKGRLDYHMSQSRKWEYLLRQSIRGTLLEP
FGVSSLEVKFRTRSENGILIHIQETSNYTTVKIKSGKVHFTSDAGVSGKVERHIPEVYVA
DGHWHSLLIGKNGSSTILSVDRIYSRDILHPTQDFGGIDVLTISLGGIPPNQAPRNTDTA
GFDGCIASVIYGSESLPFGGKHSLATISKTDPSVKLGCRGPNICASNPCWGDLLCINQWF
AYKCVPPGDCVSQPCQNGGTCEPVLYSGFTCNCPESHTGRTCETVVACLGVLCPQGSVCK
AGSAGGHVCILTKVPEEISLPLWAVPAIVGSCATLLALLVLSLILCNQCRGKKAKAPKEE
KKIKEKKKKGSENVAFDDPDNIPPYGDDMTVRKQPEGNPKPDIIERENPYLIYDETDLPP
NTETIPSAPLASPEQEIEHYDIDNASSIAPSDADIIQHYKQFRSHTPKFSIQRHSPLGFA
RQSPMPLGASSLTYQPSYSQGLRTSSLSHSACPTPNPLSRHSPAPFSKSSTFYRNSPARE
LHLSIREGGPLEVHGDMCQPGMFNYATRLGRRSKSPQTMATHGSRPGSRLKQPIGQMPLE
SAPPVGLSIEEVERLNTPRPRNPSICSADHGRSSSEEDCRRPLSRTRNPADGIPAPESSS
DSDSHESFTCSEMEYDREKPMAYTSRMPKLSQVNESDADDEDNYGARLKTRRYPGRRAEG
GSLGTQTAVANVAENTLPLKLGQQAGNFNWDNLLNWGPGFGHYVDVFKDLASLPEKTAAS
EEGNGRTSKPAFKDGEAEQYV
Download sequence
Identical sequences 13616.ENSMODP00000023552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]