SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000024170 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000024170
Domain Number 1 Region: 570-747
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.26e-39
Family SPRY domain 0.00046
Further Details:      
 
Domain Number 2 Region: 386-567
Classification Level Classification E-value
Superfamily Fibronectin type III 8.64e-24
Family Fibronectin type III 0.0026
Further Details:      
 
Domain Number 3 Region: 176-225
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000183
Family B-box zinc-binding domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000024170
Sequence length 753
Comment (Monodelphis domestica)
Sequence
MEERTGRAPLYSQDPGSGPTASQSFNFYPMDLYDSEDRLNIFPEEKIRTREVAQEPKKGE
RAPELSSATQVEELARYYGLEEDKEFEGETEAGSALRSGISEYQSAPSLRSHNVPKRRED
KDWQYLEEAADAEDDRFPGWGSRGQYQELREAYRYTRGRSSEDYECYVIPEEEDEEEAAD
IFCVTCKIPIRAFDNLFGEHKEHEVTQLNTAAENARDEIHKNMFKLEEQIIQMENFASHL
EEVFITIEENFGRQEQNFELHYNEILETLAQKYEEKMQALGEKKREKLEALYGQLVSCGE
NLDTCKELMETIEEICHEEKVEFIKVNNDKGEKLGEFLKTKTDAELSTHPDFEDQTIDFS
DVEQLMDSINAIPAPCAPVINTQTPNSATGTSVKVCWSLFSDDTVESYQLSYKPVSDGAP
TEEQKEFSVNVKESHYSVANLVPNTQYEFWVTASNSTGVSPPSERAVYVTAPSPPIIKSK
EILSCEHAALVCWESGNMNPVDSYTIELSKVDNEDSGNVVTESIVGIPTCESLIQLQPGE
SYLVYVRAINVGGPSERSEPATIHTTGSYFHLNKDTSHPLLSISEDGFTVVRGKGEKSAR
EPLESDTRFTRCVAVMGSLIPIKGRHYWEVQVDEQMDYKVGVAFQDISRHGELGADSSSW
CMSHTFTSSRHKYEFLHNGATPEIQITVPPKKIGILLDYDSYRLSFFNVDIAQHLYTFSY
PLQHFVQPCFSLEKPGMLRVCIGISMPKFATFF
Download sequence
Identical sequences 13616.ENSMODP00000024170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]