SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000024457 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000024457
Domain Number 1 Region: 87-265
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.17e-27
Family Clostridium neurotoxins, the second last domain 0.018
Further Details:      
 
Domain Number 2 Region: 355-479,543-610
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.00000000000000145
Family Reprolysin-like 0.066
Further Details:      
 
Domain Number 3 Region: 496-652
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0000000000205
Family Reprolysin-like 0.076
Further Details:      
 
Domain Number 4 Region: 1410-1477
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000375
Family Complement control module/SCR domain 0.0052
Further Details:      
 
Domain Number 5 Region: 1280-1346
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000113
Family Complement control module/SCR domain 0.0039
Further Details:      
 
Domain Number 6 Region: 1341-1413
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000181
Family Complement control module/SCR domain 0.0036
Further Details:      
 
Domain Number 7 Region: 1210-1283
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000681
Family Complement control module/SCR domain 0.0043
Further Details:      
 
Weak hits

Sequence:  13616.ENSMODP00000024457
Domain Number - Region: 671-694,875-934
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00226
Family Fibronectin type III 0.0063
Further Details:      
 
Domain Number - Region: 1549-1578
Classification Level Classification E-value
Superfamily Notch domain 0.0379
Family Notch domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000024457
Sequence length 1622
Comment (Monodelphis domestica)
Sequence
MQLWSLVLTLGFLYGSLASEPYGGMDATRRARRDTRPSRHLHSAAPGTCATRLARGRHSP
AGWEPLRAPRRRQQREVKGEEDSLIPSRALYFSGQGDQLRLKADIELPRDAFTLQVWLRA
EGGQRSPAVIAGLYDKCSYTSRDRGWAVGIHTISDQGNRDPRYFFSMKTDRARKVTTINA
HRSYLPSQWVHLAATYDGRLMKLYVNGAQVAMGSEQVGGIFSPLTLKCKVLMLGGNALNH
NYRGYIEHFSLWKTARSQKEILLDMGRANHGLGVLPHLVIQENLENVRSMWSSMKDGNSP
QVEFSYHHGLLLDTSLEPPLCGQTLCDNVEVIASYNRLPSFRRPKLVRYRVVNIYDDNHE
NPTVSQQQIEFQHQQLTEAFDRYNITWQLEVLEVKNSSLRHRLILANCDISKIGDENCDP
ECNHTLTGYDGGDCRHLRHSTFSKKKQNGVCDMDCNYERYSFDGGECCNPEITDVTKTCF
DPDSPYRAYLDVNELKNILKLDGSTHLNIFFANSSEEELAGVATWPWDKEALMHLGGIVL
NPSFYGIPGHTHTMTHEIGHSLGLYHIFRGISEIQSCSDPCMETEPSFETGDLCSDTNPA
PKHKLCGDPAPGNDTCGFRTFLNTPYNNFMSYAEDDCTDSFTPNQVARMHCYLDLVYQSW
QPAKKPAPIALMPQIVDRTPTSVTLEWFPPIDGHFFEREVGSACDLCLEGRVLVQYAFNA
SSPMPCDPSGHWSPREAEGHPDVEQPCKSSVRTWSPNSAVNHHTVPPACPEPQGCYLELE
FQYPLIPESLTVWVTLVSTDWDSSGAVNDIKLLTLSGKNISLGPQNIFCDIPLTIKIRDV
GEEVYGIQIYTLDEHLEIDAAMLTSIPESPLCRDCKPLKYKVLRDPPFQSDIPIVISNLN
RRYIDTELNHGSTYKYQIVTISGSEESEPSPTAIYIHGSGYCGDGIIQKHLGEECDDMNK
MNGDGCSLFCRKELYFNCIDEPSRCYFHDGDGVCEEFEQKTSIKDCGVYTPKGFLDQWAS
NVSVSHQDQKCPGWVIIGQPAASQMCRTKVVDLSEEVSQHAWYPCTINYQYSYMVQTTFW
LKAFFSQPMVATAVIVHLVTDGTNYLDQKQETISVQLLDTKEQNHDLGVHVLSCRSNPLI
IPVIHDLSHPFYHSQAVLVSFSSPLVAISGVALRSFYNFDPITISSCQRGETYSPAEQSC
VHFSCEATDCQELNIENASLNCSNSERYNGAQCTISCKMGYILQIHRDDDLIKSQVRSSI
TVTCTEGKWNKQVSCEPVDCGIPDQYHVYPATFSCLEGTTFGKKCSFQCRPPAQLKGNNS
FLTCMEDGLWSFPEALCELMCLAPPIVPNADLQTARCREDKHKVGSFCKFKCKPGYHVPG
SSRKSKKRAFKIQCIQDGSWLEGGCVPVTCDPPPPMFHGLYQCTNGFQFNSECRIKCEES
NISNGRGSNVIHCRKDGTWSGSFHVCKEMQGQCSLPDQLNSNLKLQCSDGYEIGAECSTS
CPDHNSESIILPMNMTIRDIPYWMNPTRVERVICTAGLKWYPHPSMIHCVKGCEPFMGDN
YCDAINNRAFCNYDGGDCCASTVKTKKVTPFPMSCDLQGDCACRDPKAQEHGRKDLRAYS
HG
Download sequence
Identical sequences 13616.ENSMODP00000024457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]