SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000024735 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000024735
Domain Number 1 Region: 280-463
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.73e-50
Family SPRY domain 0.0000842
Further Details:      
 
Domain Number 2 Region: 3-76
Classification Level Classification E-value
Superfamily RING/U-box 5.52e-17
Family RING finger domain, C3HC4 0.01
Further Details:      
 
Domain Number 3 Region: 88-150
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000101
Family B-box zinc-binding domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000024735
Sequence length 465
Comment (Monodelphis domestica)
Sequence
MAMAKLAENLKEELTCPVYMDYFSHPVNLGCGHSFCQPCLLRTWREVDKSCPCPECRRAF
QIKDLESNHCLGKLSSLARNIRPYLLQLRMERAICERHQEEQKLFCEEDQTLHCVSCFES
QEHSRHTVHLIEMAAEDSRDKLQKTLDLLWKEVEMIQNMLTEERQKMETWNEQADAWRES
IRAEYKRLYEFLKCEEKWHLQNLSRDESKNIKNLRESETRLSQHLQSLKEIIIDLEQNGQ
KPDLQLLKVGGGTLKRIKSLLSHRPEATIIQVSMAPITGIWEMMKHFRVNVTLDPESACP
YLIVSENMKTVTHRGYQQYIPVAPHQFEDSIILGAQVFTFGMHYWEVNVGESRKWAVGVC
KASLSRNASVSLSTGDVFLLTHFQKRNTYSMMTTPFCIEYHSNSPIQKVGIFLGYDQGSI
SFYDALKNSLIFRFPAFPFSDPLKPIFCPCPPRGEENGIPMTIDP
Download sequence
Identical sequences F6STE0
13616.ENSMODP00000024735 ENSMODP00000024735 ENSMODP00000024735

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]