SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000025839 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000025839
Domain Number 1 Region: 8-82
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.24e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000226
Further Details:      
 
Domain Number 2 Region: 250-316
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000263
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000877
Further Details:      
 
Domain Number 3 Region: 95-171
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000138
Family Eukaryotic type KH-domain (KH-domain type I) 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000025839
Sequence length 324
Comment (Monodelphis domestica)
Sequence
MGTRVFESGLNVTITIRLLMHGKEVGSIIGREGESVKKMREESGASINISEGNCPERTIT
LAGPTNAIFKAFAMIVDKLEEDISSSMTNSTAASRPPPPPPVTLRLVVPASQCGSLIGKG
GCKIKEMGAQVQVAGDMLPNSIRRPSLLLASRNLSKQICVVMLETLSQSPPKGGTILYPP
KLSCSPVICMGQSYTIQGQYAIPQPDLTKLHQLAMQQSHFPMTHGNTFSGIESSSPEVKG
YRAGLDASAHEFAIPNDLIGCIIGVGAKINEIRRQMSGAQIKSANAVEGSTDRQVTITGS
AASISLAQYLINVRLSSETGVGSS
Download sequence
Identical sequences F7E6A5
ENSMODP00000025839 ENSMODP00000025839 13616.ENSMODP00000025839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]