SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000026096 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000026096
Domain Number 1 Region: 2-119
Classification Level Classification E-value
Superfamily Ricin B-like lectins 3.13e-30
Family Ricin B-like 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000026096
Sequence length 122
Comment (Monodelphis domestica)
Sequence
QIRGTETAHCIDSMGHTNGGFVELGPCHRMGGNQLFRINEANQLMQYDQCLTKGPDGSKI
MITHCNLNEYKEWQYFKNLHRFTHIPSGKCLDRSPVLHQVFLSECDSNKSTQKWEMNNIL
NV
Download sequence
Identical sequences H9H7N7
ENSMODP00000026096 ENSMODP00000026096 13616.ENSMODP00000026096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]