SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000026620 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000026620
Domain Number 1 Region: 199-265
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000847
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000182
Further Details:      
 
Domain Number 2 Region: 267-360
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000215
Family Eukaryotic type KH-domain (KH-domain type I) 0.0032
Further Details:      
 
Weak hits

Sequence:  13616.ENSMODP00000026620
Domain Number - Region: 41-99
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0934
Family Chromo barrel domain 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000026620
Sequence length 662
Comment (Monodelphis domestica)
Sequence
GFIKDVHEDSLTVVFENNWQPERQVPFNEVRLPPPPDIKKEISEGDEVEVYSRANDQEPC
GWWLAKVRMMKGEFYVIEYAACDATYNEIVTFERLRPVNQNKTVKKNTFFKCTVDVPEDL
REACANENAHKDFKKAVGACRIFYHAETTQLMILSASEATVKRVNILSDMHLRSIRTKLM
LMSRNEEATKHLECTKQLAAAFHEEFIVREDLMGLAIGTHGSNIQQARKVPGVTAIELDE
DTGTFRIYGESADAVKKARGFLEFVEDFIQVPRNLVGKVIGKNGKVIQEIVDKSGVVRVR
IEGDNENKLPREDGMVPFVFVGTKESIGNVQVLLEYHIAYLKEVEQLRMERLQIDEQLRQ
IGMGFRPSSTRGPEKEKGYATDESTVSSVQGSRSYSGRGRGRRGPNYTSGYGTNSELSNP
SETESERKDELSDWSLAGEDDRESRHQRDSRRRPGGRGRSVSGGRGRGGPRGGKSSISSV
LKDPDSNPYSLLDNTESDQTADTDASESHHSTNRRRRSRRRRTDDDAVLMDGMTESDTAS
VNENGLDDSEKKPQRRNRSRRRRFRGQAEDRQPVTVADYISRAESQSRQRNLPRETLTKN
KKEMAKDVIEEHAPSEKAVNGPTSASGDDTPKLQHGPEEEKSGILKEEENSPEEAAVLNG
VS
Download sequence
Identical sequences F7G3V5
13616.ENSMODP00000026620 ENSMODP00000026620 ENSMODP00000026620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]