SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000027050 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000027050
Domain Number 1 Region: 10-74
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000047
Family Calponin-homology domain, CH-domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000027050
Sequence length 272
Comment (Monodelphis domestica)
Sequence
LLSAPLPLTALHHLYAWVDSVPFSRPKRHLARDFSDGVMIAEIVKHFQPKLVEMHNYIPT
SNTEQKLSNWSTLNRQVFPKLRFYVSEEDIRRVVISTPGAIESVLSTLRQKVEEKCQKKA
AQESRAGTFSANSVFLFSLPLSPSPPMEKARQREPLTKRLNDPLYLQGSPKSWLWSPTLP
RSRTFFCAGLRSPPPPGGPCVGDGQGWLTPGGLCGRRLLSADRRLCLQTQLLEEKEQAMP
MLQETVQILQMKVHRLEHLVQLKDMRIEDLTR
Download sequence
Identical sequences H9H8C8
ENSMODP00000027050 13616.ENSMODP00000027050 ENSMODP00000027050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]