SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000027121 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000027121
Domain Number 1 Region: 127-269
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.98e-17
Family Laminin G-like module 0.0000562
Further Details:      
 
Domain Number 2 Region: 1-104
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000245
Family Laminin G-like module 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000027121
Sequence length 270
Comment (Monodelphis domestica)
Sequence
RYDLGKGAAVIRSKEPIALNKWTRVSLERNGRKGAMRVNDGDRVLGESPKSRKMPHTVLN
LKEPLYVGGAPDFSKLARAAAVSGGFDGAIQLVSLKGRQLLTRENVRDAVEISSFPDHPC
TQASGQPCLNGGSCSPQQDTYECLCLGGFSGVHCEKGLIEKSAADLDSIAFDGRTFIEYH
NAVTTSELTNEIPAPDAMDSGVLPSEKALQENHFELSLRTEAMQGLVLWSGKGTERADYI
ALAIVNGRLQMTYDLGSQPVVLHSTVPVNT
Download sequence
Identical sequences 13616.ENSMODP00000027121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]