SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000027406 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000027406
Domain Number 1 Region: 323-504
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.88e-47
Family SPRY domain 0.0000564
Further Details:      
 
Domain Number 2 Region: 12-87
Classification Level Classification E-value
Superfamily RING/U-box 9.5e-20
Family RING finger domain, C3HC4 0.012
Further Details:      
 
Domain Number 3 Region: 101-160
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000412
Family B-box zinc-binding domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000027406
Sequence length 504
Comment (Monodelphis domestica)
Sequence
IFFTDSSSPGFKNMDAKNLTENLKAELTCPICLSYFTDPVTVKCGHSFCIECLLRCKEGA
NETLVCPECRGIIKYSDLILNRSLQNLSITGKKVRPHLLQSMVTICDNHWEKEKIFCEED
HRLLSDPCLLSQEHKDHQVLPLEMVADRCKKRLQETRNILKIREEEFKMALDSVERIKTQ
YKKDIYTLKQSVIYEYEEMHQFLLEEKNLQLQRLGEESRDNLAKLEEDKAKLSQQIKKLQ
QMILEVEENLDKAPLETIQEIKKTKEQNTKAVIYFLPSGYESHLGKVNNSNRMCPICRSE
KLMLQEPEVTSPNWITCSITGLREMLMSFHTDITLDPKTINPPLILSEDMKSVEYRRAPQ
DLLNNEEKFNYVFKVLGTQIFSSGKHYWEVEVGYQIGWEVGICEINKKVTHSTIFENIRT
IVSFKFGNNFFHWNSQGGYHVSQPVNKVGIFLDVEKGYIAFYDAMNNSLIYSLQNVVFRR
PLCPFFSPCLPVGMSSYGYLMVCP
Download sequence
Identical sequences H9H9C6
ENSMODP00000027406 ENSMODP00000027406 13616.ENSMODP00000027406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]