SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000028568 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000028568
Domain Number 1 Region: 307-473
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.11e-44
Family SPRY domain 0.0000839
Further Details:      
 
Domain Number 2 Region: 33-99
Classification Level Classification E-value
Superfamily RING/U-box 1.17e-18
Family RING finger domain, C3HC4 0.016
Further Details:      
 
Domain Number 3 Region: 113-174
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000473
Family B-box zinc-binding domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000028568
Sequence length 473
Comment (Monodelphis domestica)
Sequence
PKSKSSHLWRPALSLLGPASEKPGNMDAQLLVGQLKADLTCSICLGYFRDPVIVKCGHSF
CTECLLRCGQGTQATFTCPECRGAIQYGQRLPNRNLQNLSLTGQMLRPHLLHSIVGLTTC
VQHGQREELFCQQHQAALCHCCSSAPEHEHHQILPLEEAAHRGHQMLQKTHTLLQAKEEE
FQMALDSVSCRETQCKVEASILGRSLSSEYEKMHQFLWEEERRRMDQLRQQSTHNLSKYV
EIRVKLEQHIQHLQGMIVEVEDNLDKAPLQMLQDMKDTLAKKEKLLLLPEPEVASPHWNI
QPITGLREMLRSFHRDITMDPQTASPHLVFSEDLKSVRYGRGPQNLLGQEDTPDYSLTVL
GAQTFSSGKHYWEVEVRGLPEWEVGICPASGCTKSSPSSLLDDVRVLAGQTSEQAFLLWH
PQYGYRECQPLQKVGIFLDFGRGHVAFYDATDGSLLLRFPEQGFQGPLRPCFS
Download sequence
Identical sequences F7D9L5
ENSMODP00000028568 ENSMODP00000007672 13616.ENSMODP00000028568

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]