SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000028779 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000028779
Domain Number 1 Region: 282-467
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.89e-51
Family SPRY domain 0.0000712
Further Details:      
 
Domain Number 2 Region: 3-84
Classification Level Classification E-value
Superfamily RING/U-box 1.54e-27
Family RING finger domain, C3HC4 0.0069
Further Details:      
 
Domain Number 3 Region: 94-153
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000011
Family B-box zinc-binding domain 0.0026
Further Details:      
 
Weak hits

Sequence:  13616.ENSMODP00000028779
Domain Number - Region: 135-237
Classification Level Classification E-value
Superfamily Cullin repeat-like 0.0228
Family Cullin repeat 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000028779
Sequence length 469
Comment (Monodelphis domestica)
Sequence
SSPREMDVSEMTEKVRSELTCSICLDLFTQPVTLDCGHSFCRECVLRSWQEAQVPWTCPL
CRASSQPRALEPTQVLEALASSISRQLRLPRDVGGQARCGQHQAVQKLFCEDDFSPLCVS
CLLPQEHEDHRVYPLEESAETCKAQLQEALGQAWDKAREAHMLLEQERERRLRCRREAAT
LKRVILPEYIKTHLVWTEDQQQDLLDKEKRRNVKRLWTSEARISKYVQSLRKLIEELDKT
LEQPLVEMLLAGRSTLERSRELLLRCPEPAALSWTLCGTTGMRELLLAFQSHILLDPGTA
HSYLSISGDLKSVRLASHWWHLLDNQQEEVERLVCVLGAQSFTSGSHYWEVEVGSKTEWE
VGICTGPGNNQGSIHGDVLSLSCLNMGEQFELWISHTMEDPEDTGPLHRLGIFLQYEGGH
LSFYNVTQGCLIYAFPPVTFQGPLRPFFSLGLLQEENQPIPLTICPLSP
Download sequence
Identical sequences F7C4U3
ENSMODP00000028779 13616.ENSMODP00000028779 ENSMODP00000028779

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]