SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000029473 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000029473
Domain Number 1 Region: 1-221
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.53e-84
Family Calponin-homology domain, CH-domain 0.00000128
Further Details:      
 
Domain Number 2 Region: 1724-1903
Classification Level Classification E-value
Superfamily Plakin repeat 5.1e-50
Family Plakin repeat 0.00032
Further Details:      
 
Domain Number 3 Region: 2348-2571
Classification Level Classification E-value
Superfamily Plakin repeat 9.59e-46
Family Plakin repeat 0.0002
Further Details:      
 
Domain Number 4 Region: 1503-1720
Classification Level Classification E-value
Superfamily Plakin repeat 4.05e-44
Family Plakin repeat 0.00019
Further Details:      
 
Domain Number 5 Region: 6023-6181
Classification Level Classification E-value
Superfamily Spectrin repeat 9.6e-31
Family Spectrin repeat 0.0015
Further Details:      
 
Domain Number 6 Region: 6461-6619
Classification Level Classification E-value
Superfamily Spectrin repeat 1.71e-29
Family Spectrin repeat 0.0028
Further Details:      
 
Domain Number 7 Region: 5037-5197
Classification Level Classification E-value
Superfamily Spectrin repeat 2.62e-28
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 8 Region: 2658-2763
Classification Level Classification E-value
Superfamily Plakin repeat 1.18e-23
Family Plakin repeat 0.0013
Further Details:      
 
Domain Number 9 Region: 237-353
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-23
Family Spectrin repeat 0.0082
Further Details:      
 
Domain Number 10 Region: 4604-4759
Classification Level Classification E-value
Superfamily Spectrin repeat 4.61e-23
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 11 Region: 5587-5741
Classification Level Classification E-value
Superfamily Spectrin repeat 2.59e-22
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 12 Region: 6614-6731
Classification Level Classification E-value
Superfamily Spectrin repeat 8.64e-22
Family Spectrin repeat 0.0061
Further Details:      
 
Domain Number 13 Region: 6264-6402
Classification Level Classification E-value
Superfamily Spectrin repeat 2.16e-21
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 14 Region: 5191-5307
Classification Level Classification E-value
Superfamily Spectrin repeat 2.02e-20
Family Spectrin repeat 0.0038
Further Details:      
 
Domain Number 15 Region: 6952-7031
Classification Level Classification E-value
Superfamily GAS2 domain-like 3.4e-20
Family GAS2 domain 0.00055
Further Details:      
 
Domain Number 16 Region: 6680-6856
Classification Level Classification E-value
Superfamily Spectrin repeat 2.22e-19
Family Spectrin repeat 0.0063
Further Details:      
 
Domain Number 17 Region: 5822-5962
Classification Level Classification E-value
Superfamily Spectrin repeat 4.32e-19
Family Spectrin repeat 0.0036
Further Details:      
 
Domain Number 18 Region: 3743-3857
Classification Level Classification E-value
Superfamily Spectrin repeat 1.83e-18
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 19 Region: 5257-5402
Classification Level Classification E-value
Superfamily Spectrin repeat 2.62e-18
Family Spectrin repeat 0.0046
Further Details:      
 
Domain Number 20 Region: 4318-4432
Classification Level Classification E-value
Superfamily Spectrin repeat 3.72e-18
Family Spectrin repeat 0.0045
Further Details:      
 
Domain Number 21 Region: 5366-5518
Classification Level Classification E-value
Superfamily Spectrin repeat 7.44e-18
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 22 Region: 6149-6254
Classification Level Classification E-value
Superfamily Spectrin repeat 1.02e-16
Family Spectrin repeat 0.0058
Further Details:      
 
Domain Number 23 Region: 3578-3700
Classification Level Classification E-value
Superfamily Spectrin repeat 3.17e-16
Family Spectrin repeat 0.0049
Further Details:      
 
Domain Number 24 Region: 4816-4976
Classification Level Classification E-value
Superfamily Spectrin repeat 4e-16
Family Spectrin repeat 0.0091
Further Details:      
 
Domain Number 25 Region: 1212-1338,1365-1391
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000011
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 26 Region: 6863-6943
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000000013
Family Polcalcin 0.057
Further Details:      
 
Domain Number 27 Region: 667-769
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000157
Family Spectrin repeat 0.0033
Further Details:      
 
Domain Number 28 Region: 2550-2654
Classification Level Classification E-value
Superfamily Plakin repeat 0.0000000000000288
Family Plakin repeat 0.0051
Further Details:      
 
Domain Number 29 Region: 4493-4614
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000552
Family Spectrin repeat 0.006
Further Details:      
 
Domain Number 30 Region: 4201-4322
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000209
Family Spectrin repeat 0.0053
Further Details:      
 
Domain Number 31 Region: 3824-3963
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000514
Family Spectrin repeat 0.0077
Further Details:      
 
Domain Number 32 Region: 5739-5850
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000417
Family Spectrin repeat 0.0067
Further Details:      
 
Domain Number 33 Region: 4039-4152
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000168
Family Spectrin repeat 0.0082
Further Details:      
 
Domain Number 34 Region: 734-852
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000024
Family Spectrin repeat 0.0081
Further Details:      
 
Domain Number 35 Region: 2287-2364
Classification Level Classification E-value
Superfamily Plakin repeat 0.0000000068
Family Plakin repeat 0.0018
Further Details:      
 
Domain Number 36 Region: 576-665
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000301
Family Spectrin repeat 0.0091
Further Details:      
 
Domain Number 37 Region: 3357-3476
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000811
Family Spectrin repeat 0.0096
Further Details:      
 
Domain Number 38 Region: 3238-3350
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000262
Family Spectrin repeat 0.0049
Further Details:      
 
Domain Number 39 Region: 1409-1523
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000964
Family Spectrin repeat 0.0065
Further Details:      
 
Weak hits

Sequence:  13616.ENSMODP00000029473
Domain Number - Region: 4951-5029
Classification Level Classification E-value
Superfamily Spectrin repeat 0.046
Family Spectrin repeat 0.019
Further Details:      
 
Domain Number - Region: 3125-3226
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0864
Family Spectrin repeat 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000029473
Sequence length 7247
Comment (Monodelphis domestica)
Sequence
DERDRVQKKTFTKWVNKHLMKVRKHINDLYEDLRDGHNLISLLEVLSGIKLPREKGRMRF
HRLQNVQIALDFLKQRQVKLVNIRNDDITDGNPKLTLGLIWTIILHFQISDIYISGESGD
MSAKEKLLLWTQKVTAGYTGIKCTNFSSCWSDGKMFNALIHRYRPDLVDMERVQIQSNRE
NLEQAFEVAERLGVTRLLDAEDVDVPSPDEKSVITYVSSIYDAFPKVPEGGEGISATEVD
SRWQEYQNRVDSLIPWIKQHTMLMSEKSFPQNPVELKALYNQYIHFKETEILAKEREKGR
IEELYKLLEVWIEFGRIKLPQGYHPNDVEEEWGKLIIEMLEREKLLRPAVERLELLLQIA
NKIQNGALRCEEKLTLAKNTLQADTAQVESGQPLQHEPDAIMYLQECEGLIRQLQNGILI
TGKSREVTDELGLKGSLEFHEANVRKESTTVIWSDRLLEYCQTRYRLQGYTEKKSLIFLT
ELNIKLSFHLFLIFHSRIMRLQDELVSWKLECTNLFFNTLEFVQPSTLTTTHLKTNPLTK
GTHPPSTSWFRKPMTRAELVSISSSEDEGSLRFVYELLSWVEEMQMKLERAEWGNDLPSV
ELQLETQQHTHTSVEELGSSVKEARMYEGKMSQNFRASYTETLGKLETQYCKLMETSSFR
LRNLQSLHKFVSKATTELIWLNEKEEEELAFDWSDNNPNITAKKNYFSELTMELDDKQDV
FRSLQDTAELLSLENHPAKQTVEAYSAAIQSQWQWMKQLCLCVEHHVKENSTYFQFFSDA
KDLETFLKNLQDSIKRKYSCDCNTSLSRLEDLLQDSMDEKEQLIHSKSSVASLVGRSKTI
IQLKPRNPDHVLASTISIKAICDYRQIEITIYKNDECVLEDNSQRTKWKVISPTGNEAMV
PSVCFLIPPPNTDAIEVANRVEQAYQKVMTLWHQLHMNTKSLISWHYLRKDIDLVQSWNL
EKLRSLASAESHQVMENLQTHYEDFLQDSRDSSLFSVSDRLHLEEEVDSCKAHYQQLAES
LENEDKDETVARTYISELTNIRLRLEDCEQRLIRRIQSPTGSRTDEDARQDNALRIAEQE
HTQEDLQQLRTDFDNISMRCKTFLQQSPSGSSIPTLQSEFSLLVEKMTQVYGLSSVYLDK
LKTIDVIVRDIQGAELLVKGYEIKLSQEEAVPADLSALQSHRAALEQWLKDVKDKNSVFL
VLDEEIAKAKMVAEQLCRLMPERSLDLERCQERGSQLQERWHRVAAQIESRQSELESIQE
VLRDYRSCHGALIQWIEETTAQQEVMKPGQAEDSRLLSEQLSQQTALVAEIERNQAKLDQ
CQKFSQQYSASVKDYELQLMTYRAFVESQQKSPGKRRRMLSSSDAITQEFMDLRTRYTAL
VTLTTQHVKYISDALRRLEEEEKVVEEEKQEHVEKVKDLLVWVSALARSPQGKAISSQGK
ELTDIEKAILEQQVLTEELATKKEQISEAIKTSQIFLAKHGHKLSDQEKEQISEQLKALK
TTYQEMCDGSAQQIQQLQGQLAQKTEQKGSRTVAGVIDLGTVEIFPIFKAMQKGLIDQDT
GLVLLEAQVIMSGLDVPETNEKVSLEEGLSRSLIDQQTCQLLQELEDAYSSLNLLSEGTS
HLSVVEAMEKGKISERVGMKILEVLLATGSFPVSSTEKQISLKEASYQELTTAHLHSKIE
THLRSCKNLIDPNTAEKISLLDLMHRCIVHQDSGLRLLPVKQLAGGMVSLKSGRKVSIFR
AVQEGLIDRQVTVRLLEAQLFAGGIVDPRTGHRLTVDEAVRYNLIDQDMACAILIRQLQT
GGIIDTVTGYRLTIDEALRKDLITSKMALVILQSLWSFMGLLWPESGEILSIADALEQGI
ISTELAYEILSNRKYIKALFQPATTEIWSWKKAVEKGILDKDVAKNLKSTCIPDVMPHMQ
LAVSSESPLGVSALVTAPLYSQDQSGHVPGSYHEKLLFYLMTHSYIDVHSGHRLLLLDEG
LLELLTLGQRETSHVHPLETCEVSQRSLKALREIKDSASLRHPEVDTQDGLNIRHQELQI
VLKEGSPKEQPTNSQTGRKKMTLEVNFSTTFESEKKSFPEEREVRIPNLSGLKSILNTEP
EQQRQTSKIKKEEPKKLYSNEESMGVASRTSFVGLTKEAQGIQFSIDNEPLSAGLKRKDR
STLTETVSTLQEQGVIFRIEKEAYISGRIGGDLVKLQSEQSESQEEKTLYPDTETKPLNI
KALYFLEKERTMSELIKEEEREVQNQSLEKEKITNESLKMVKKSTEAMSVDGVMEMSLDH
LLEPSEDATLKMLSAQLENGGIYHNETGQKLLLNEAVSWGIVPSHTAVKLMEKLKMFRGF
FDSQTCESLTTEEVIDEGLMNENLLQKVFTSDKTISGVLDPYTNTVHSVRDAVRVGLLGK
QTAMRILEGQVVTGGIVDLKRDKKVSVTLASNLGLVDSADQKELICLEKATKGKDSEKIT
KQKLIGLQIETNGIIDPETKTPLTVVQSINKGLLEREEAIQLLTKQVVDGGIIHHDSGMR
LSVDNATEHGLIDGDLSKELKQVENMCLHQFIHPTTKVLISLPEAIAIGLVTLDFTNQAQ
EIQALKGSFVDPISGQRLSLSEAIRTKLSSNEATLSSGMMHGIVDPENCKIIPYSEFIKK
CKIDVESGQRYLEIIPFSDIRDEVTGKQLTLSEAAQFGKVDLVPVLRLLEAQADSGGIFD
ITTGKRLSLKAALEQKLVDEKMVQLIATHQVLNGGIIDVSSGQRVTLIEAAERGLIHPEL
VASIQKDIHKTNDSSQIEIQRGTESCELKNEFPRREILAVYKQASEISCYENQEETEKLF
LIEKRAIDEKTKIRILESSQEAESLGRTKRPIPVPEAKLSQERTPKDEQDSPKNLQAKEQ
TVQEREEESSVNQKFPLTYKAKDIAPQAMSIGTIEQNTQDVDIFLTFNPVKSLQNPSVSF
RDKENVSDSRSDSPKERSHQEIICELLIPDNTKVHWGSSITLKEKPLQEVTGEYPISLVP
FTSEKPLQDIPRAVIREPQKDTVHAKFKSQSSPENNGEKTVPLASTQAGNLDEKTDQEKV
ILSSSSEQSLFVTSAKGKENEDTSQEPFKAAKVIDSNDSINENLSNHILSLRRLCLEHDE
QLVSYLSLLRNIEMRTKQICPAELSLAELQDQLRQAKVLDRELRDLSTLVNHELECVHQI
VTTQPQEVPAQLLKALEKDAKNLQKSFSSVSDTWASRLLSLQNSVDAEKTKILNQYEVLQ
GRLQELGTWINETRHSLYNMEHVSKSDATNLNNLLKEYEALKQPFSERRSQLDILALDIQ
YFISEHAQNLSPQQSRKLLRLLNELQKAFHELSVHAIAQKDALQGCLQQAMQAAQVQTLQ
EQKNTCHQKLEDLCAWVSQAEQTLTGHHVRGGSPEDLSTLQQKQDSDLQKDVQNRAISFA
NIIKDTEGFLEENQTKLNPHELSSLREKLLQAKEQSEALQERTRMAKKELEEAVTLALQQ
ESEKVTKAAKELEENKSKIDALLDWVASLESTSGLPKSSFPKLEDSPGGSLGNGITDTLD
GYSEMSHAPEKLDQLYEGAKTRHQELLSQQQDFILATQAAQAFLDKYSHSLAPEEQQKLQ
QKLGDLKEQYSASLAQAETELKQMQALRDELQKFLRDHREFEDWLQQAEQELENVHKGGG
DPAALQSLLLRQRSFSEDVISHKGDLRFVTMSGQKVLDTENSSRGGTEPSATRHLVTSKL
DDATQRYTALHSKCNKLGSHLNMLLEHSQQFQSSADGLQAWIEECESKVNQLLSDPVASD
PTVLQQQLTNTKQLQGGLAEHQVPVEKLQKAAEALLEMEGEPAPDPQHIQETTDSILGHF
QSLSGRLEERADLLQKAIAQSQSVQEGLENLLQSIIEVEKSLEGEQVASLTSTAIQEALA
INMKLKQDIVRQKSSLEATREMVTQFMETADGATATGLQGKLAEVSEQFSQLCQRQQEKE
SSLKKLLPQVEMFEHISEKLQQFLDSRARMLATGNQPDRDIAQFSQQIQELNLEMGEQQE
NLDALEHLVIDLSSCGFALDTSQHEERVQKLKKDFMGLQKSVQEREKETSSCQEQLDEFR
KLVQALQKWLKESEGNMPVMESSMSTRDLQKQIEQLEALLDDWTSKGLQVEEINRKGLAL
ENLIVEITAPETQSKTGKNQPSAQATISDLLSVSLKLDLTEIQCHMSDVSQQYEKLGGVL
QERRDSLLAMLSSMQEVQEEASSLLQWLESKENALKAFDASSSPTKTETMRAQAECNKAF
LAELEQNSPKIHKVKEALAGLLKKYPNSQEAKHWKEMEEELSSRWERANEVTAARQQKLE
ESANQLASFQAAETQLRPWLTEKELMMSVLGPLSIDPNMLNAQKQQVQFMLKEFEARKPQ
HEQLNQAAQGILTGPGDGSPSASQVQEELQNINNKWIELTDRLNSRSSQIDQTLVKSTQY
QELLQNLSERVKAVGQQLNGQSAISTQPAAVKQQLEETSEIRSDLEQLDHEITDAQALCD
ELSTLIGEQYLKDELRKRLETVALPLKGLEDLAADRMNKLQTALASTQQFQQMFDELRTW
LDDKQNQQAKAQPISAKLDRLHCQLQEQEEFQKSLNQRSGSYEVIIIEGESLLLSVHPGE
EKKTLQSQLIELKSHWEELSKKAADRQSRLKDCLQKAQKYQWHVEDLIPWIEDCKAKMSD
LQVTLDPVQLEAHLLRSKAMLTDVEKRRSLLEMLNSTADILINSSQTDEDDIRDEKAGIN
QNMDAITEELQAKTESLEEMTQRLKEFQDSYKNIEKKLDGAKHQLEIFDALGPQACSNKN
LEKLRAQQEVLQALEPQVDYLKNFTQGLVEDAPQGSDASQLQHQAEVTEQDFMEVKERVN
SSCVAMENKLEGIGQFHCRVREMFSQLADLDDELDSMRAIGRDIDSLQSQIEDVRLFLSK
IQSLKLDIKASEGECRQMLEEEGSLDLLGLKRELEALSKQCGKLTERGKARQEQLELTLA
RVGDFYSKMKELNDMTTAAEEGEALQWVVGTEVDAINQQLADFKMFQKEQVDPLQMKLQQ
VNGLGQGLIQSAGKHCDVQGLEHDMEEINARWNTLNKKVAQRIAQLQEALLHCGKFQDAL
EPLLSWLADTEDLIANQKPPSAEYKVVKAQIQEQKLLQRLLDDRKATVDMLQAEGERIAQ
SAELADREKIISQLESLGRRWTELLSKAASRQKQLEDILVLAKQFHETAEPVSDFLSVTE
KKLANSEPVGTQTAKIQQQIARHKALEEEIESRAADVQQAVRVGQSLSSLTYPAEQGVLA
ERLEALQARYSEVQERCCRKAALLEQAIANARLFGEDEVEVLNWLAEAEDKLSSVFVKDY
RQDVLQKQHADHLALNEEIVNRKKTVDQAVKNGQALLKQTTGEEVLLIQEKLDGIKTRYA
DLTVSSSKALRTLEQARQLATKFQSTHDELTGWMSKVEEELMASGGQSPTGEQIPQFQQR
QKELKKEVMEHRLVLDTVNEVSRALLELVPWRAREGLDKLVSDANDQYKLVSDTIGQRVD
EIDAAIQRSQQYEQAADAELAWVAETKRKLMALGPIRLEQDQTTAQLQVQKAFSIDIIRH
KDSMDELFSQRSEIFGSCGEEQKALLQEKTESLVQQYEAISQLNSERYARLERAQVLVNQ
FWETYEELSPWIEETQTLISQLPPPAIDHEQLKQQQEEMRQLRESIAEHKPHIDKLLKIG
PQLKELNPNEGEMVQEKYQKAETTYARIKEEVRRRALALDEAVSQSAQFHDKMEPMLETL
ENLSSRLRIPPLIPAEVDKIRECLSDNKSTAMELEKLQPSFEALKRRGEELIGRSQGADK
DLAAKEIQDKLDQMVFFWEDIKAQAEEREVKFLDVLELAEKFWYDMAALLATIKDTQDIV
HDLESPGIDPSIIKQQVEAAETIKEETDGLHEELEFIRILGADLIFACGETEKPEVKKSI
DEMNNAWENLNKTWRERLEKLEEAMQAAVQYQDTLQTMFDWLDNTVIKLCNMPPVGTDLN
TVKDQLNEMKEFKMEVYQQQIEMEKLNHQGELMLKKATDETDRDIIREPLTELKHLWENL
GEKIAHRQHKLEGALLALGQFQHALEELMSWLTHTEELLDAQRPINGDPKVIEVELAKHH
VLKNDVLAHQATVDTVNKAGNELLESSAGDDDASSLRNRLETMNQCWESVLQKTEEREQQ
LQSTLQQAQGFHSEIEDFLLRLTRMENQLSSSKPTGGLPETAREQLDAHMELYDQLKGQE
ETYNQLLDKGRLMLLSRDDSGSGSKTEQSVTLLEQKWHVVSSKMEERKSKLEEVLNLATE
FQNSLQEFINWLTLAEQSLNIAPPPSLILNTILLQIDEHKVFANEVNAHRDHIIELDQTG
NQLKFLSQKQDVVLIKNLLVSVQSRWEKVVQRSVERGRSLDDARKRAKQFHEAWKKLIDW
LEDAENHLDSELEISNDPDKIKLQLSRHKEFQKTLGGKQPVYDTTIRTGRALKEKTSLPD
DVQKLDNCLGEVRDKWDTVCGKSVERQHKLEEALLFSGQFMDALQALVDWLYKVEPQLAE
DQPVHGDLDLVMNLMDAHKVFQKELGKRTGTVQVLKRLGRELIENSRDDTTWVRVQLQEL
STRWDTVCKLSVSKQTRLEHALKQAEEFRNAVHMLLEWLSEAEQTLRFRGALPDDTEALQ
SLIDVHKEFMKKVEEKRVDVNASVAMGEDILAMCHPDCVTTIKHWITIIRARFEEVLTWA
KQHQQRLEAALSELIANAELLEELLAWIQWAETTLIQRDQEPTPQNIDRVKSLISEHQAF
MEEMTRKQPDVDRVTKTYKRKAIEPTHAPFIEKSRSNRKSLGQTAPPPMPLLSQSEAKNP
RIHQLSARWQQLKEFANFDFDVWRKKYMRWMNHKKSRVMDFFRRIDKDQDGKITRQEFID
GILASKFPTTKLEMTAVADIFDRDGDGYIDYYEFVAALHPNKDAYRPTTDADKIEDEVTR
QVAQCKCAKRFQVEQIGENKYRFFLGNQFGDSQQLRLVRILRSTVMVRVGGGWMALDEFL
VKNDPCRVHHPGSKIKRSDSSSSMASQSSIARGRTNIELREKFILPEGVSQGMTPFRSRG
RRSKPSSRAASPTRSSSSASQSNHSCASMPSSPATPASGAKVMPSTGSKLKRPAFHSSRT
SLTGDASNSSSPVSSSAKTNRADAKKTTSRPTSRAGSRTGSRASSRRGSDASDFDLLETQ
SACSDTSESSTAGGQGSSRRGLTKPSKIPTMSKKTATASPRTPGPKR
Download sequence
Identical sequences 13616.ENSMODP00000029473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]