SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000029530 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000029530
Domain Number 1 Region: 1-33,92-174
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000266
Family Tetratricopeptide repeat (TPR) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000029530
Sequence length 185
Comment (Monodelphis domestica)
Sequence
AYFRQGVALQYLGRHADALAAFASGLAQDPKSLQLLVGMVEAAMKSPMRESLEPTYQQLQ
KMKLDKSPFVVVSVVGQELLTAGHHGASVVVLEAALKIGTCSLKLRGSVFSALSSAYWSL
GNTEKSTGYMQQDLDVAKTLGDQTGECRAHGNLGSAFFSKGNYREALTNHRHQLVLAMKL
KDREV
Download sequence
Identical sequences 13616.ENSMODP00000029530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]