SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000031545 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000031545
Domain Number 1 Region: 360-510
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.31e-53
Family SPRY domain 0.0000378
Further Details:      
 
Domain Number 2 Region: 5-115
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000185
Family V set domains (antibody variable domain-like) 0.0086
Further Details:      
 
Domain Number 3 Region: 128-200
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000434
Family C1 set domains (antibody constant domain-like) 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000031545
Sequence length 510
Comment (Monodelphis domestica)
Sequence
TDKLKVTGSIHPTVAKRGEDVTLSCHLSPETYAKHMKVRWFQVHFFHPGHMDVDMNRKPI
AEDKRISTEPDAINKGIVTLKIFHVDTSDNGQYWCRFEQNGLFQEASLELKVAGLGSSPQ
IYLKGNKDGRLQLVCTSEGWFPQPLMWWRVEGGENLSSLSEDRIQDINGLFHVETSVMIR
NDSMGDVICSIYNPLLETSQSDFFLDFFPLDPLPSSIHTYLLPILSLRFSPFPEPILFHS
FIFRWNCCLDQEFCTLSRPYPAILFTSVHSKVLQSLMLWSILASCWSQKMLNYLIEFLNL
FYSIYPSLPGSKGLFISMSLCLKEDSHCKSEALNTIEGGGVILWERGNKQGELTPSYQNS
KTAHPELIISEKGRYMTRGNMRQNLPDNPQRFNFLPSVLGQKKITSGKHYWEVEVGPGSG
WFLGICREDVNRKRDTQVTPENGFWIIGSYGNDYWAITSPSTLLSLRVSPHKICVSLDYH
RGQLSFKNVTDGSHIHTFHITSFSGTLRPF
Download sequence
Identical sequences 13616.ENSMODP00000031545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]