SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000031661 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000031661
Domain Number 1 Region: 9-124
Classification Level Classification E-value
Superfamily POZ domain 2.75e-24
Family BTB/POZ domain 0.0013
Further Details:      
 
Domain Number 2 Region: 384-436
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000529
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 3 Region: 334-389
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000229
Family Classic zinc finger, C2H2 0.03
Further Details:      
 
Weak hits

Sequence:  13616.ENSMODP00000031661
Domain Number - Region: 164-174
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00118
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000031661
Sequence length 462
Comment (Monodelphis domestica)
Sequence
MASGVEVLRFQLPGHEAATLRNMNQLRAEERFCDVTIVADSLKFRGHKVILAACSPFLRD
QFLLNPSSELQVSLMHSARIVADLLLSCYTGALEFAVRDIVNYLTAASYLQMEHVVEKCR
NALSQFIEPKIGLKEDGIGGGIGLTGLTSTKSLLPPARTPKPAPKPPPPPPPPPLLRPVK
LEFPLDEDLELKAEEEEEDEEEDVSDICIVKVESALEVAQRLKPPGGIGGSLGLGGSLGS
SGLLINEVGETIDAPDDSTAPQGVVKACYSLTEDTEGEGLLLFPGGRVGEGITLGLGDEA
LAAATMSRSSGVSGSYGGIRSPIPGGSPVGNPLKNIKCTKCPEVFQGVEKLVFHMRAQHF
IFMCPRCGKQFNHSSNLNRHMNVHRGVKSHSCGICGKCFTQKSTLHDHLNLHSGARPYRC
SYCDVRFAHKPAIRRHLKEQHGKTTAENVLDASVSELNALLH
Download sequence
Identical sequences 13616.ENSMODP00000031661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]