SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000032306 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000032306
Domain Number 1 Region: 28-278
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.97e-93
Family Calponin-homology domain, CH-domain 0.00000334
Further Details:      
 
Domain Number 2 Region: 2182-2296
Classification Level Classification E-value
Superfamily PH domain-like 2e-33
Family Pleckstrin-homology domain (PH domain) 0.0000168
Further Details:      
 
Domain Number 3 Region: 294-415
Classification Level Classification E-value
Superfamily Spectrin repeat 3.01e-33
Family Spectrin repeat 0.0000742
Further Details:      
 
Domain Number 4 Region: 600-740
Classification Level Classification E-value
Superfamily Spectrin repeat 2.66e-30
Family Spectrin repeat 0.00026
Further Details:      
 
Domain Number 5 Region: 1636-1789
Classification Level Classification E-value
Superfamily Spectrin repeat 4.45e-28
Family Spectrin repeat 0.0013
Further Details:      
 
Domain Number 6 Region: 1847-2001
Classification Level Classification E-value
Superfamily Spectrin repeat 1.78e-27
Family Spectrin repeat 0.0012
Further Details:      
 
Domain Number 7 Region: 814-949
Classification Level Classification E-value
Superfamily Spectrin repeat 2.76e-24
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 8 Region: 1224-1371
Classification Level Classification E-value
Superfamily Spectrin repeat 2.16e-23
Family Spectrin repeat 0.00081
Further Details:      
 
Domain Number 9 Region: 424-526
Classification Level Classification E-value
Superfamily Spectrin repeat 1.31e-22
Family Spectrin repeat 0.00032
Further Details:      
 
Domain Number 10 Region: 911-1049
Classification Level Classification E-value
Superfamily Spectrin repeat 9.03e-22
Family Spectrin repeat 0.0019
Further Details:      
 
Domain Number 11 Region: 1058-1169
Classification Level Classification E-value
Superfamily Spectrin repeat 1.68e-21
Family Spectrin repeat 0.00000948
Further Details:      
 
Domain Number 12 Region: 1478-1579
Classification Level Classification E-value
Superfamily Spectrin repeat 2.52e-21
Family Spectrin repeat 0.00027
Further Details:      
 
Domain Number 13 Region: 528-635
Classification Level Classification E-value
Superfamily Spectrin repeat 4.17e-19
Family Spectrin repeat 0.00055
Further Details:      
 
Domain Number 14 Region: 744-848
Classification Level Classification E-value
Superfamily Spectrin repeat 6.24e-19
Family Spectrin repeat 0.0019
Further Details:      
 
Domain Number 15 Region: 1988-2066
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000209
Family Spectrin repeat 0.0016
Further Details:      
 
Domain Number 16 Region: 1345-1436
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000262
Family Spectrin repeat 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000032306
Sequence length 2334
Comment (Monodelphis domestica)
Sequence
MTSATEFDNLGIQQYSRINARWDSPDNELDNDNSSARLFERSRIKALADEREVVQKKTFT
KWVNSHLARVSCRIADLYKDLRDGRMLIKLLEVLSGEMLPKPTKGKMRIHCLENVDKALQ
FLKEQRVHLENMGSHDIVDGNHRLVLGLIWTIILRFQIQDIVVQTQEGQETRSAKDALLL
WCQMKTSGYPHVNVTNFTSSWKDGLAFNALIHKHRPDLIDFEKLKDSNARHNLEHAFDVA
ERQLGIIPLLDPEDVFTENPDEKSIITYVVAFYHYFSKMKVLAVEGKRVGKVIDHAIETE
KMIEKYSGLASDLLTWIEQTITVLNSRKFANSLSGLQQQLQSFSTYRTVEKPPKFQEKGN
LEVLLFTIQSRMRANNQKVYTPHEGKLVSDINRAWESLEEAEYRRELALRNELIRQEKLE
QLARRFDRKAAMRETWLSENQRLVAQDNFGYDLAAVEAAKKKHEAIETDTAAYEERVKAL
EDLAQELEKENYHDLKRIKARKDNILRMWSYLLDLLQSRRQRLEMTLTLQKLFQDMLHSI
DWIDEIKVHLLSSEFGKHLLEVEDLLQKHKLMEADIAIQGDKVKAITSAALQFTDGKGYQ
PCDPQVIQDRVSHLEQCFGELSSMAAGRKARLEQSKRLWKFFWEMDEAESWIKEKEQIYS
SLDYGKDLTSVLILQRKHKAFEDELRGLDAHLEQMMKEAEEMVAQKHFGHPQIEARIREV
SALWDQLKELAAFRKKNLQDAENFFQFQGDADDLKAWLQDAHRLLLGEDVGQDEGATRAL
GKKHKDFLEELEESRGVMEHLEQQAQGFPQEFRDSPDVNNRLQALRELYQQVVAQADLRR
QRLQDALDLYTVFGETDACELWMGEKEKWLAQMEIPHTLEDLEVVQHRFDILDQEMKTLM
TQIDGVNLAANSLVESGHPRSGEVKTCQDHLNQRWEAFQTMVSKHRKAVDSALSVQNYYV
DCEETGKWILDKTEVVKSTQDLDQDLAGVIAIQRKLYGIERDVAAIQSRVGALECESQRL
IQEHPQLKEDIGRRQAHIEKLWEQLQEALKSQKASLGEASKLQKFLQDLDDFQAWLFMAQ
KVVASEDAPNSLPEAEQLIQQHAAIKEEIDEHKNDYQNVKDSGEEVIRGPEYQPLRQRLE
GVDTGWDALCKMWENRGQFLVQCLGFQEFQKDAKQAEAILSNQEYTLAHLEPPDSLEAAE
AGIRKFEDFLVAMDNNQDKILKTVASGNELINNGNIYSDKIKEKVLLIEDRHKKNNEKSQ
EAAILLRDNLDLQNFLQNCQELTLWINDKLLSSQDISYEEARNLHNKWQKHQAFMAELAS
NQGWLEKVDKEGRQLIEVKPQFTDVVTQRLKKLHRLWDELQATTQEKAQHLFAASRSDLH
AQTYADLNKWISAMEDQLRSDDPGKDLTSVNRMLTKLKRVEDQVNVRKKELGELLSQVPP
VGGEGDGTEPSIEKRFLDLLVPLGKRKKQLESSRAKLQINRDIEDETLWVEERLPLAQSS
DYGTNLQSVQLLMKKNQTLQNEIVGHTPRIEDVLHRGHELVEVAEIDCQDIAERLGHLQD
SWKLLQDETTLRLQRLQEANEAQQYYLDAGETVAWISEQELYVISDETPKDEESAIVMLK
RHLRQQRSVEDYGKNIKQLAGRAQKLLSAGHPKGEQIIRLQGKVDKQYAGLKDMAEERKR
KLENMYHLFQLKREADDLEQWIAEREVVASSQEMGQDFDHVTLLRDKFRDFARETGAIGQ
ERVDNVNLIIERLIDAGHAEAATIAEWKDGLNEIWADLLELIDTRMQLLAASYDLHRYFY
MGEEILGLIDEKHRELPEDVGLDASTAESFHRVHTAFERELHLLGVQVQQFQDVATRLQT
AYAGEKADEIQSKEQEVSTAWQALLDACAGRRTQLVDTADKFRFFSMVRDLLSWMESIIR
QIETQEKPRDVSSVELLMKYHQGIKAEIETRSKNFSTCLELGESLLQRQHQASEEIKEKL
NQVISRRQEMMEKWEDRSERLRLLLEVCQFSRDASVAEAWLIAQEPYLASRDFGHTVDSV
EKLIKRHEAFEKSTAPWAERFAALEKPTTLELKERHTPERPTEDSGAQEEEGETAGEPPR
SLHRVATERTSPVTENGAHTTTLTLPSSPPPSRGSHFSSQPQEKKTGREDKLTLEPLFKV
LDTPLSENEETATTLPAQLDRSHSMQMEGYLGRKHDLEGPNKKASNRSWNNLYCVLRNNE
LTFYKDAKNLAMGVPYHGEEPLGLRHAICEVAADYKKKKHVFKLRLSNGSEWLFHGKDEE
EMLSWLQGVSTAITESQSIQVKTQSLPLPSIASTDTSLGKKDKEKRFSFFPKKK
Download sequence
Identical sequences 13616.ENSMODP00000032306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]