SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000032762 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000032762
Domain Number 1 Region: 3-103
Classification Level Classification E-value
Superfamily POZ domain 1.08e-32
Family Tetramerization domain of potassium channels 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000032762
Sequence length 260
Comment (Monodelphis domestica)
Sequence
MSDPITLNVGGKLYTTSLSTLTSFPDSMLGAMFSGKMPTKKDSQGNCFIDRDGKVFRYIL
NFLRTSHLDLPEDFQEMGLLRREADFYQVQPLIEALQEKEVELSKAEKNAMLNITLNKRV
QNIHFTVREAPQIYSLSSSDMEVFNANIFSTSGLFLKLLGSKLFYCFNGNLSSISSYLQD
PNHLTLDWVASVDGLPEEEYTKQNLKRLWVVPANKQINSFQVFVEEVLKIALSDGFCVDS
SHPHLSDFMNNKIIRLIRYR
Download sequence
Identical sequences F7G745
ENSMODP00000032762 XP_007490950.1.35504 XP_007490952.1.35504 XP_007490953.1.35504 XP_016277453.1.35504 XP_016277454.1.35504 XP_016277455.1.35504 13616.ENSMODP00000032762 ENSMODP00000032762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]